| Clone Name | rbart31d12 |
|---|---|
| Clone Library Name | barley_pub |
>POL_HTLV2 (P03363) Pol polyprotein [Contains: Reverse| transcriptase/ribonuclease H (EC 2.7.7.49) (EC 3.1.26.4) (RT); Integrase (IN)] Length = 982 Score = 32.3 bits (72), Expect = 0.67 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -2 Query: 357 PWQDLQPIVGSILIPIDGAKSWLPESLRKKKEAP 256 P Q LQ G+ L+ IDG+ W+P KK P Sbjct: 930 PLQSLQEAAGAALLSIDGSPRWIPWRFLKKAACP 963
>TTDN1_HUMAN (Q8TAP9) TTD nonphotosensitive 1 protein| Length = 179 Score = 32.0 bits (71), Expect = 0.88 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -2 Query: 402 SQDQRNYYRKSMVDDPWQDLQPI 334 S + NY++ SM++DPW L+P+ Sbjct: 133 SNELENYFKPSMLEDPWAGLEPV 155
>CCNF_MOUSE (P51944) G2/mitotic-specific cyclin-F| Length = 776 Score = 30.8 bits (68), Expect = 2.0 Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = +3 Query: 369 WTSCSSSSDLA-IQNGCGSHPFPLFLLALGCCSSSRPCH 482 ++S SSSS ++ + G G P +L++G SS++PCH Sbjct: 696 YSSVSSSSPISSLDGGMGGSPQSTSVLSVGSHSSTKPCH 734
>TTDN1_MOUSE (Q9D011) TTD nonphotosensitive 1 protein homolog| Length = 178 Score = 30.0 bits (66), Expect = 3.3 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = -2 Query: 402 SQDQRNYYRKSMVDDPWQDLQPI 334 S + +Y++ SM++DPW L+P+ Sbjct: 132 SNELESYFKPSMLEDPWAGLEPV 154
>CENPF_HUMAN (P49454) CENP-F kinetochore protein (Centromere protein F) (Mitosin)| (AH antigen) Length = 3210 Score = 29.6 bits (65), Expect = 4.4 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 5/77 (6%) Frame = +2 Query: 14 LCI*SERSSLTYRRNKLKG--DEYMLRTTAILMVQKFMLKGSPDT---KNSCHVSLDSLE 178 +C+ E S +T RN+L+G D +TTA+ + + M + + + ++ C + E Sbjct: 2043 VCLEEELSVVTSERNQLRGELDTMSKKTTALDQLSEKMKEKTQELESHQSECLHCIQVAE 2102 Query: 179 ASLKDKSRYSAGLNPDV 229 A +K+K+ L+ DV Sbjct: 2103 AEVKEKTELLQTLSSDV 2119
>TCF8_MOUSE (Q64318) Transcription factor 8 (Zinc finger homeobox protein 1a)| (MEB1) (Delta EF1) Length = 1117 Score = 29.3 bits (64), Expect = 5.7 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = -2 Query: 351 QDLQPIVGSILIPIDGAKSWLPESLRKKKEAPNQGRTIPNPTSG 220 ++L I S+ +P+DG K W + + + P Q P+P +G Sbjct: 587 EELSKIADSVNLPLDGVKKWFEK--MQAGQIPGQSPDPPSPGTG 628
>LAML1_CAEEL (Q18823) Laminin-like protein C54D1.5 precursor| Length = 1535 Score = 28.9 bits (63), Expect = 7.5 Identities = 18/56 (32%), Positives = 25/56 (44%) Frame = -2 Query: 402 SQDQRNYYRKSMVDDPWQDLQPIVGSILIPIDGAKSWLPESLRKKKEAPNQGRTIP 235 S + YY+K DD + + +L I +K LP SLRK K + IP Sbjct: 1477 SNENLQYYKKQAEDDKQMATEAVRKQLLPRILPSKQMLPFSLRKMKSRKSSILWIP 1532
>AKAP6_RAT (Q9WVC7) A-kinase anchor protein 6 (Protein kinase A-anchoring| protein 6) (PRKA6) (mAKAP) Length = 2314 Score = 28.5 bits (62), Expect = 9.7 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 2/73 (2%) Frame = +2 Query: 122 LKGSPDTKNSCHVSLDSLEASLKDKSRYSAGLNPDV--GFGIVRPWLGASFFLRNDSGSQ 295 LK SP + ++ + S KD S S PD+ G G+VRP+ S L +SGS+ Sbjct: 1303 LKSSPKFTGTTQPTVLTKSLS-KDSSFSSTKSLPDLLGGSGLVRPYSCHSGDLSQNSGSE 1361 Query: 296 DLAPSMGISMLPT 334 S G + +PT Sbjct: 1362 SGIVSEGDNEMPT 1374
>LUM_RABIT (O46379) Lumican (Keratan sulfate proteoglycan lumican) (KSPG| lumican) (Fragment) Length = 192 Score = 28.5 bits (62), Expect = 9.7 Identities = 17/35 (48%), Positives = 19/35 (54%) Frame = -2 Query: 222 GLSPAEYLDLSFNEASNESNET*HEFLVSGLPFSM 118 GL EYLDLSFN+ S L SGLP S+ Sbjct: 91 GLKSLEYLDLSFNQMSK---------LPSGLPASL 116
>GS17_XENLA (P07733) Gastrula-specific protein 17| Length = 147 Score = 28.5 bits (62), Expect = 9.7 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 417 HNHSGSQDQRNYYRKSMVDDPWQDLQ 340 H +D +YY SM++DPW LQ Sbjct: 116 HQPGSYRDISHYYSPSMLEDPWAALQ 141 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,020,371 Number of Sequences: 219361 Number of extensions: 1266767 Number of successful extensions: 3793 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3708 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3793 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)