ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart31d07 |
|---|---|
| Clone Library Name | barley_pub |
>SBP2_ARATH (Q9M2Z4) Putative steroid binding protein 2 (AtMP2)| Length = 233 Score = 32.3 bits (72), Expect = 0.77 Identities = 13/15 (86%), Positives = 15/15 (100%) Frame = -3 Query: 509 YKFMSKYVKVGTVKK 465 YKFMSKYVKVGT++K Sbjct: 154 YKFMSKYVKVGTIQK 168
>VCAM1_RAT (P29534) Vascular cell adhesion protein 1 precursor (V-CAM 1)| Length = 739 Score = 32.0 bits (71), Expect = 1.0 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -3 Query: 215 GDMVLVRCYC*SVPECWILL 156 GD V++ C C SVPE WI+L Sbjct: 616 GDTVIISCTCGSVPEIWIIL 635
>MSBP1_ARATH (Q9XFM6) Membrane steroid-binding protein 1 (AtMP1)| Length = 220 Score = 31.6 bits (70), Expect = 1.3 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -3 Query: 509 YKFMSKYVKVGTVKKA 462 YKFMSKY KVGTVK A Sbjct: 158 YKFMSKYAKVGTVKVA 173
>LEU2_GLUOX (Q5FUG3) 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33)| (Isopropylmalate isomerase) (Alpha-IPM isomerase) (IPMI) Length = 475 Score = 31.2 bits (69), Expect = 1.7 Identities = 19/63 (30%), Positives = 30/63 (47%) Frame = +2 Query: 47 SLQNTGHRYFRQQLNYSPKSINRRLNKWETRPHSATPVISSTPGPTNNNSEPAPYPHVQV 226 SL + YF ++ + + I + W T P + P+ S P P++ EP P Q+ Sbjct: 269 SLASDDGAYFDTEVTLAAEEIIPSVT-WGTSPQNVLPIDGSVPSPSD---EPDPARAAQI 324 Query: 227 QRA 235 QRA Sbjct: 325 QRA 327
>VCAM1_MOUSE (P29533) Vascular cell adhesion protein 1 precursor (V-CAM 1)| Length = 739 Score = 30.8 bits (68), Expect = 2.2 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -3 Query: 215 GDMVLVRCYC*SVPECWILL 156 GD V++ C C +VPE WI+L Sbjct: 616 GDTVIISCTCGNVPETWIIL 635
>VCAM1_HUMAN (P19320) Vascular cell adhesion protein 1 precursor (V-CAM 1)| (CD106 antigen) (INCAM-100) Length = 739 Score = 30.8 bits (68), Expect = 2.2 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -3 Query: 215 GDMVLVRCYC*SVPECWILL 156 GD V++ C C +VPE WI+L Sbjct: 616 GDTVIISCTCGNVPETWIIL 635
>CCDC9_HUMAN (Q9Y3X0) Coiled-coil domain-containing protein 9| Length = 531 Score = 30.0 bits (66), Expect = 3.8 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +2 Query: 77 RQQLNYSPKSINRRLNKWETRPHSATPVISSTPGPTNNNSEPAPYP 214 R Q +P++ + ++WET+ +A+P TP PT+ + P P Sbjct: 351 RPQAKAAPRAYSDHDDRWETKEGAASPA-PETPQPTSPETSPKETP 395
>MEF2C_MOUSE (Q8CFN5) Myocyte-specific enhancer factor 2C| Length = 474 Score = 29.6 bits (65), Expect = 5.0 Identities = 18/54 (33%), Positives = 25/54 (46%) Frame = +2 Query: 107 INRRLNKWETRPHSATPVISSTPGPTNNNSEPAPYPHVQVQRAGTNYILNDTDL 268 +N+R+N ++ ATPV+ S PT YP GT Y L+ DL Sbjct: 278 LNQRINNSQSAQSLATPVV-SVATPTLPGQGMGGYPSAISTTYGTEYSLSSADL 330
>MEF2C_HUMAN (Q06413) Myocyte-specific enhancer factor 2C| Length = 473 Score = 29.6 bits (65), Expect = 5.0 Identities = 18/54 (33%), Positives = 25/54 (46%) Frame = +2 Query: 107 INRRLNKWETRPHSATPVISSTPGPTNNNSEPAPYPHVQVQRAGTNYILNDTDL 268 +N+R+N ++ ATPV+ S PT YP GT Y L+ DL Sbjct: 278 LNQRINNSQSAQSLATPVV-SVATPTLPGQGMGGYPSAISTTYGTEYSLSSADL 330
>YL8J_SCHPO (Q9UTA1) Hypothetical zinc finger protein C25B8.19c in chromosome I| Length = 522 Score = 29.6 bits (65), Expect = 5.0 Identities = 19/40 (47%), Positives = 21/40 (52%) Frame = +2 Query: 104 SINRRLNKWETRPHSATPVISSTPGPTNNNSEPAPYPHVQ 223 SINRR N E P S+ P +T G N PYPHVQ Sbjct: 8 SINRRNN--ENPPQSSLP---TTSGIVYNMFPACPYPHVQ 42
>VCAM1_CANFA (Q28260) Vascular cell adhesion protein 1 precursor (V-CAM 1)| Length = 739 Score = 29.3 bits (64), Expect = 6.5 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -3 Query: 215 GDMVLVRCYC*SVPECWILL 156 GD V++ C C +VP+ WI+L Sbjct: 616 GDTVIISCTCGNVPKTWIIL 635
>CHEB1_PSEPU (O52262) Chemotaxis response regulator protein-glutamate| methylesterase of group 1 operon (EC 3.1.1.61) Length = 374 Score = 29.3 bits (64), Expect = 6.5 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +2 Query: 110 NRRLNKWETRPHSATPVISSTPGPTNNNSEPAPYPHVQVQRA 235 NRRL + A PV +S+P P ++ + PAP RA Sbjct: 133 NRRLGSYARPAPVAAPVPASSPAPASSFASPAPARPAATARA 174
>R1AB_CVPPU (Q9IW06) Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein)| [Includes: Replicase polyprotein 1a (pp1a) (ORF1a)] [Contains: p9; p87; p195 (EC 3.4.22.-) (Papain-like proteinases 1/2) (PL1-PRO/PL2-PRO); Peptide HD2; Unknown protein 1; 3C-like Length = 6684 Score = 29.3 bits (64), Expect = 6.5 Identities = 9/33 (27%), Positives = 22/33 (66%) Frame = -3 Query: 260 YHSVCNLYQHVGLGHGDMVLVRCYC*SVPECWI 162 +H VCN++++ + GD ++ RC ++ +C++ Sbjct: 5782 HHEVCNIHRNEHVASGDAIMTRCL--AIHDCFV 5812
>ARFA_ARATH (Q8L7G0) Auxin response factor 1| Length = 665 Score = 28.9 bits (63), Expect = 8.5 Identities = 15/39 (38%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +2 Query: 98 PKSINR--RLNKWETRPHSATPVISSTPGPTNNNSEPAP 208 P S+ R R++ WE P A SS P P N P P Sbjct: 338 PSSVFRPERVSPWELEPLVANSTPSSQPQPPQRNKRPRP 376
>R1AB_CVH22 (Q05002) Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein)| [Includes: Replicase polyprotein 1a (pp1a) (ORF1a)] [Contains: p9; p87; p195 (EC 3.4.22.-) (Papain-like proteinases 1/2) (PL1-PRO/PL2-PRO); Peptide HD2; 3C-like proteinase (EC 3.4 Length = 6758 Score = 28.9 bits (63), Expect = 8.5 Identities = 9/33 (27%), Positives = 23/33 (69%) Frame = -3 Query: 260 YHSVCNLYQHVGLGHGDMVLVRCYC*SVPECWI 162 +H++CN++++ + GD ++ RC +V +C++ Sbjct: 5848 HHAICNVHRNEHVASGDAIMTRCL--AVYDCFV 5878
>YZLL_CAEEL (Q93847) Hypothetical WD-repeat protein K04G11.4| Length = 395 Score = 28.9 bits (63), Expect = 8.5 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +2 Query: 146 SATPVISSTPGPTNNNSEPAPYPHVQVQRAGTNYIL 253 ++TP++SSTPGP + +S P P P+ Y L Sbjct: 64 ASTPMLSSTPGP-SYSSAPTPMPNPSAANLWPTYKL 98 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,860,738 Number of Sequences: 219361 Number of extensions: 1264086 Number of successful extensions: 3697 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 3463 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3688 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3754426130 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
