Clone Name | rbart31d05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YFRD_SCHPO (Q9UT43) Putative phospholipid-transporting ATPase C8... | 29 | 9.7 |
---|
>YFRD_SCHPO (Q9UT43) Putative phospholipid-transporting ATPase C821.13c (EC| 3.6.3.1) Length = 1562 Score = 28.9 bits (63), Expect = 9.7 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 166 FLQQPSVDLYYARPTAASQVKSKSVFDSLSQ 258 FL Q +DLYY +V+S S+ + L Q Sbjct: 647 FLVQSDIDLYYPENDTRCEVRSSSILEELGQ 677 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,369,961 Number of Sequences: 219361 Number of extensions: 683102 Number of successful extensions: 1288 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1288 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4315578075 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)