Clone Name | rbart31c12 |
---|---|
Clone Library Name | barley_pub |
>ZO1_HUMAN (Q07157) Tight junction protein ZO-1 (Zonula occludens 1 protein)| (Zona occludens 1 protein) (Tight junction protein 1) Length = 1748 Score = 32.0 bits (71), Expect = 0.45 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -1 Query: 199 HRPVSIEESTFERNERLVSGIPNPKTRRPCYCEL 98 H P ++EE T ERNE+ +P PK P Y ++ Sbjct: 362 HTPKTVEEVTVERNEKQTPSLPEPK---PVYAQV 392
>ZO1_MOUSE (P39447) Tight junction protein ZO-1 (Zonula occludens 1 protein)| (Zona occludens 1 protein) (Tight junction protein 1) Length = 1745 Score = 29.6 bits (65), Expect = 2.2 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -1 Query: 199 HRPVSIEESTFERNERLVSGIPNPKTRRPCYCEL 98 H P ++EE T E+NE+ +P PK P Y ++ Sbjct: 362 HPPKAVEEVTVEKNEKQTPTLPEPK---PVYAQV 392
>ATS19_HUMAN (Q8TE59) ADAMTS-19 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase with thrombospondin motifs 19) (ADAM-TS 19) (ADAM-TS19) Length = 1207 Score = 28.9 bits (63), Expect = 3.8 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +1 Query: 124 FSGWECQKLSVH-SSQKYFLQWRRV 195 F W+CQ SV SS K+ LQW+ V Sbjct: 692 FRDWQCQAYSVRTSSPKHILQWQAV 716
>PRP16_YEAST (P15938) Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16| (EC 3.6.1.-) Length = 1071 Score = 28.5 bits (62), Expect = 5.0 Identities = 16/62 (25%), Positives = 31/62 (50%) Frame = +1 Query: 34 PRRYKLRTAIAADRFT*KSAQTVHSSKGVLFSGWECQKLSVHSSQKYFLQWRRVDGNRNV 213 P+ + IA ++F A++ H + +F W S H K+F+Q++ + R++ Sbjct: 821 PKERQKEADIARNKFF--IAKSDHLTLLNVFEQWRANNFSSHWCNKHFVQYKSLVRARDI 878 Query: 214 RD 219 RD Sbjct: 879 RD 880
>MELB_ECOLI (P02921) Melibiose carrier protein (Thiomethylgalactoside permease| II) (Melibiose permease) (Na+ (Li+)/melibiose symporter) (Melibiose transporter) Length = 469 Score = 27.7 bits (60), Expect = 8.4 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = -1 Query: 91 HFFK*TCRLLLLCVAYNVWVVMW*LLSCPF 2 H F+ T +++ +CV Y +W + + ++ PF Sbjct: 94 HLFEGTTQIVFVCVTYILWGMTYTIMDIPF 123
>MELB_SALTY (P30878) Melibiose carrier protein (Thiomethylgalactoside permease| II) (Melibiose permease) (Na+ (Li+)/melibiose symporter) (Melibiose transporter) Length = 476 Score = 27.7 bits (60), Expect = 8.4 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = -1 Query: 91 HFFK*TCRLLLLCVAYNVWVVMW*LLSCPF 2 H F+ T +++ +CV Y +W + + ++ PF Sbjct: 98 HLFEGTAQVVFVCVTYILWGMTYTIMDIPF 127 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,616,625 Number of Sequences: 219361 Number of extensions: 559691 Number of successful extensions: 1058 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1056 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1058 length of database: 80,573,946 effective HSP length: 48 effective length of database: 70,044,618 effective search space used: 1681070832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)