| Clone Name | rbart31c10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RBP1C_ARATH (P92985) Ran-binding protein 1 homolog c | 44 | 4e-04 | 2 | RBP1B_ARATH (Q8RWG8) Ran-binding protein 1 homolog b | 42 | 0.001 | 3 | RBP1A_ARATH (Q9LMK7) Ran-binding protein 1 homolog a (Ran-bindin... | 41 | 0.002 | 4 | Y1079_METJA (Q58479) Hypothetical protein MJ1079 | 30 | 3.1 | 5 | YRB1_YEAST (P41920) Ran-specific GTPase-activating protein 1 (Ra... | 29 | 9.0 |
|---|
>RBP1C_ARATH (P92985) Ran-binding protein 1 homolog c| Length = 219 Score = 43.5 bits (101), Expect = 4e-04 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -3 Query: 523 ELKEEMFAIRFGSVENCKKFKDLVDEIAEQQ 431 ELK+E+F IRF S+ENCK F + EIAE Q Sbjct: 129 ELKDELFCIRFASIENCKTFMEKFTEIAESQ 159
>RBP1B_ARATH (Q8RWG8) Ran-binding protein 1 homolog b| Length = 217 Score = 41.6 bits (96), Expect = 0.001 Identities = 18/31 (58%), Positives = 22/31 (70%) Frame = -3 Query: 523 ELKEEMFAIRFGSVENCKKFKDLVDEIAEQQ 431 ELK+E+F IRF SVENCK F E+AE + Sbjct: 132 ELKDELFCIRFASVENCKAFMQKFKEVAESE 162
>RBP1A_ARATH (Q9LMK7) Ran-binding protein 1 homolog a (Ran-binding protein| siRanBP) Length = 228 Score = 41.2 bits (95), Expect = 0.002 Identities = 17/31 (54%), Positives = 22/31 (70%) Frame = -3 Query: 523 ELKEEMFAIRFGSVENCKKFKDLVDEIAEQQ 431 ELK+E+F IRF S+ENCK F E+AE + Sbjct: 130 ELKDELFCIRFASIENCKTFMQKFKEVAESE 160
>Y1079_METJA (Q58479) Hypothetical protein MJ1079| Length = 397 Score = 30.4 bits (67), Expect = 3.1 Identities = 17/49 (34%), Positives = 28/49 (57%) Frame = -2 Query: 269 YFIICSRSIAILELANCQVGVIRFILWSEFIFLSQIFVVLFCGMDAWVG 123 + I+ S +IAI+ L N ++ FI F FLS +F ++FC + +G Sbjct: 302 FSILISSTIAIIILLNLSKYILLFIRKVNFKFLS-LFFIIFCSLVVIIG 349
>YRB1_YEAST (P41920) Ran-specific GTPase-activating protein 1 (Ran-binding| protein 1) (RANBP1) (Perinuclear array-localized protein) Length = 201 Score = 28.9 bits (63), Expect = 9.0 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -3 Query: 505 FAIRFGSVENCKKFKDLVDEIAE 437 FAIRFGS EN KFK+ ++ E Sbjct: 174 FAIRFGSKENADKFKEEFEKAQE 196 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,691,141 Number of Sequences: 219361 Number of extensions: 1399268 Number of successful extensions: 3383 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3300 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3381 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 3970331829 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)