Clone Name | rbart30h07 |
---|---|
Clone Library Name | barley_pub |
>LONH_METJA (Q58812) Putative protease La homolog (EC 3.4.21.-)| Length = 649 Score = 30.4 bits (67), Expect = 2.4 Identities = 13/28 (46%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +3 Query: 168 SSHDSILTGPKPC-FLLVLGGNRDDLYH 248 SS ++ T P PC F+L++ GN DD+Y+ Sbjct: 273 SSGATVETNPIPCDFILIMSGNMDDVYN 300
>SHCBB_XENLA (Q640F2) SHC SH2 domain-binding protein 1 homolog B| Length = 698 Score = 29.3 bits (64), Expect = 5.3 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = +1 Query: 223 EETETTSIISS-LVAGYRRKGRLHKPQHTRLGVELATHSHI 342 EE E +I++ LVA RRK +LHK + + LG+ A +++ Sbjct: 631 EEAEGNQVIATELVANTRRKTQLHKKRLSTLGIVTADDNNL 671
>YA71_SCHPO (Q09758) Hypothetical protein C24H6.01c in chromosome I| Length = 588 Score = 29.3 bits (64), Expect = 5.3 Identities = 14/41 (34%), Positives = 18/41 (43%), Gaps = 6/41 (14%) Frame = -1 Query: 374 WHVLWHAFLRWIWLCVASSTPKRVCC------GLWSLPFLR 270 WH + W WL V P+R+CC GL P+ R Sbjct: 467 WHDISWELFAWGWLIVLFILPERLCCFMSRRTGLTKHPYYR 507
>SHCBA_XENLA (Q6GPE9) SHC SH2 domain-binding protein 1 homolog A| Length = 699 Score = 28.9 bits (63), Expect = 6.9 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +1 Query: 223 EETETTSIISS-LVAGYRRKGRLHKPQHTRLGVELA 327 EE E +I++ LVA RRK +LHK + + LG+ A Sbjct: 633 EEAEGNQVIATELVANTRRKTKLHKKRLSTLGIVTA 668
>NRFI_WOLSU (Q9S1E4) Protein nrfI| Length = 902 Score = 28.5 bits (62), Expect = 9.1 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 211 YWCWEETETTSIISSLVAGYRRKGRLHKPQH 303 YW W+ ET S IS L+ RL +P+H Sbjct: 799 YWAWDPKETWSYISILLYALILHLRLLRPKH 829
>HIS8_ACEPA (P45358) Histidinol-phosphate aminotransferase (EC 2.6.1.9)| (Imidazole acetol-phosphate transaminase) Length = 356 Score = 28.5 bits (62), Expect = 9.1 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 308 RVCCGLWSLPFLR*PATSELMIEV 237 +V CGL+SLPF P T ++ + V Sbjct: 115 KVYCGLYSLPFRNVPLTDDMQVNV 138 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,411,070 Number of Sequences: 219361 Number of extensions: 1337775 Number of successful extensions: 3025 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2965 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3022 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)