Clone Name | rbart30g07 |
---|---|
Clone Library Name | barley_pub |
>PGIP1_ORYSA (Q8GT95) Polygalacturonase inhibitor 1 precursor| (Polygalacturonase-inhibiting protein) (Floral organ regulator 1) Length = 332 Score = 65.5 bits (158), Expect = 6e-11 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -1 Query: 463 CGPLPKLHGVMRHGCKPYEHNLCHRGAPLESSCHQ 359 CGPLP+LHGV+RHGCKPYEHN C GAPL CHQ Sbjct: 298 CGPLPRLHGVIRHGCKPYEHNQCAGGAPL-GGCHQ 331
>TCB1_RABIT (P06333) T-cell receptor beta chain ANA 11| Length = 319 Score = 30.8 bits (68), Expect(2) = 0.16 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 5/38 (13%) Frame = +2 Query: 38 YMIHPDSRTRAHTHSLGEAHLQT-----VHTHTARTHL 136 Y++HP + HTH+ H+ +HTHT THL Sbjct: 55 YLLHPHTHVCTHTHTCTHTHIHASTHVCIHTHTF-THL 91 Score = 22.3 bits (46), Expect(2) = 0.16 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +3 Query: 228 YTKPPSTVLRSSYTRTYAHENANTDRH 308 +T + L + TRTYAH A T H Sbjct: 94 HTLTHALTLTCAPTRTYAHTRAPTHVH 120
>WRN_MOUSE (O09053) Werner syndrome ATP-dependent helicase homolog (EC 3.6.1.-)| Length = 1401 Score = 30.8 bits (68), Expect = 1.8 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = +2 Query: 62 TRAHTHSLGEAHLQTVHTHTARTHLYRLVVHKASSSQGPRLSGITTVPARYSTPL 226 T H+ + A L T ++ RTH Y++ +S + P+ S + P S+PL Sbjct: 1052 TTQHSSNQNPAGLTTKQSNLERTHSYKVPEKVSSGTNIPKKSAVMPSPGTSSSPL 1106
>GRIP2_HUMAN (Q9C0E4) Glutamate receptor-interacting protein 2 (GRIP2 protein)| Length = 1043 Score = 30.4 bits (67), Expect = 2.3 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 3/78 (3%) Frame = +3 Query: 147 SYTKLAALKDRACQAL-PQYQRGTPPH*YTKPPSTVLRSSYTRTYAHENANTDRHHSSYN 323 SYT AA + Q P + RG+PP P+ R+SYT T A E+ + + Sbjct: 801 SYTPQAAARGTTPQERRPGWLRGSPP------PTEPRRTSYTPTPADESFPEEEEGDDWE 854 Query: 324 VP--PSAGGEVAQSWWQL 371 P P+ G + +W++ Sbjct: 855 PPTSPAPGPAREEGFWRM 872
>VP4_ROTBC (P08713) Outer capsid protein VP4 (Hemagglutinin) (Outer layer| protein VP4) [Contains: Outer capsid protein VP8; Outer capsid protein VP5] Length = 776 Score = 29.6 bits (65), Expect = 3.9 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 3/23 (13%) Frame = -1 Query: 460 GPL---PKLHGVMRHGCKPYEHN 401 GPL PKL+GVM+HG K Y +N Sbjct: 156 GPLLSTPKLYGVMKHGGKIYTYN 178
>CRVP_OPHHA (Q7ZT98) Ophanin precursor (Opharin)| Length = 239 Score = 29.3 bits (64), Expect = 5.1 Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 1/57 (1%) Frame = +3 Query: 258 SSYTRTYAHENANTDRHHS-SYNVPPSAGGEVAQSWWQLLSSGAPRWQRLCS*GLHP 425 S TR + D H+S +V P+A + W+ +S A RW C+ G P Sbjct: 24 SESTRRQKKQKEIVDLHNSLRRSVSPTASNMLKMQWYPEAASNAERWASNCNLGHSP 80
>IRS2_HUMAN (Q9Y4H2) Insulin receptor substrate 2 (IRS-2)| Length = 1338 Score = 29.3 bits (64), Expect = 5.1 Identities = 23/75 (30%), Positives = 32/75 (42%) Frame = +3 Query: 234 KPPSTVLRSSYTRTYAHENANTDRHHSSYNVPPSAGGEVAQSWWQLLSSGAPRWQRLCS* 413 +P S S + T+ RHH N+PPS G V +S L++ P + CS Sbjct: 301 RPRSKSQSSGSSATHPISVPGARRHHHLVNLPPSQTGLVRRSRTDSLAATPPAAK--CS- 357 Query: 414 GLHPCRMTPCSLGSG 458 CR+ S G G Sbjct: 358 ---SCRVRTASEGDG 369
>CRVP1_NAJAT (Q7T1K6) Natrin-1 precursor (Cysteine-rich venom protein 1)| (NA-CRVP1) (Protein G2a) Length = 239 Score = 28.9 bits (63), Expect = 6.7 Identities = 16/52 (30%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Frame = +3 Query: 258 SSYTRTYAHENANTDRHHS-SYNVPPSAGGEVAQSWWQLLSSGAPRWQRLCS 410 S TR + D H+S V P+A + W+ +S A RW CS Sbjct: 24 SESTRRKKKQKEIVDLHNSLRRRVSPTASNMLKMEWYPEAASNAERWANTCS 75
>VP4_NCDV (P17465) Outer capsid protein VP4 (Hemagglutinin) (Outer layer| protein VP4) [Contains: Outer capsid protein VP8; Outer capsid protein VP5] Length = 775 Score = 28.5 bits (62), Expect = 8.7 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -1 Query: 451 PKLHGVMRHGCKPYEHN 401 PKL+GVM+HG K Y +N Sbjct: 162 PKLYGVMKHGGKIYTYN 178
>RF2_THEMA (Q9X1R5) Peptide chain release factor 2 (RF-2)| Length = 369 Score = 28.5 bits (62), Expect = 8.7 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 288 NANTDRHHSSYNVPPSAGGEVAQSWWQLLSSGAPRW 395 N D +++ +V P AGG +Q W Q+L RW Sbjct: 119 NGKYDPNNAYLSVHPGAGGTESQDWAQMLLRMYMRW 154
>KHDR3_RAT (Q9JLP1) KH domain-containing, RNA binding, signal| transduction-associated protein 3 (Sam68-like mammalian protein 2) (SLM-2) (rSLM-2) Length = 346 Score = 28.5 bits (62), Expect = 8.7 Identities = 14/54 (25%), Positives = 26/54 (48%), Gaps = 7/54 (12%) Frame = +3 Query: 207 RGTPPH*YTKPPSTVLRSSYTR-------TYAHENANTDRHHSSYNVPPSAGGE 347 RG PP Y PP + +Y + A+++ + D + +SY+ P +G + Sbjct: 247 RGVPPTGYRPPPPPPTQETYGEYDYDDGYSTAYDDQSYDSYDNSYSTPAQSGAD 300
>DERM_BOVIN (P19427) Dermatopontin (Tyrosine-rich acidic matrix protein)| (TRAMP) (22 kDa extracellular matrix protein) (Dermatan sulfate proteoglycan-associated protein 22K) Length = 183 Score = 28.5 bits (62), Expect = 8.7 Identities = 12/48 (25%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +3 Query: 270 RTYAHENANTDRHHSSYNVP-PSAGGEVAQSWWQLLSSGAPRWQRLCS 410 R+ ++ +DR + +P P + GE + WW+ ++ W + CS Sbjct: 42 RSIFNKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCS 89
>VP4_ROTSF (P17463) Outer capsid protein VP4 (Hemagglutinin) (Outer layer| protein VP4) [Contains: Outer capsid protein VP8; Outer capsid protein VP5] Length = 776 Score = 28.5 bits (62), Expect = 8.7 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -1 Query: 451 PKLHGVMRHGCKPYEHN 401 PKL+GVM+HG K Y +N Sbjct: 162 PKLYGVMKHGGKIYTYN 178
>VP4_ROTB5 (P36305) Outer capsid protein VP4 (Hemagglutinin) (Outer layer| protein VP4) [Contains: Outer capsid protein VP8; Outer capsid protein VP5] Length = 776 Score = 28.5 bits (62), Expect = 8.7 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -1 Query: 451 PKLHGVMRHGCKPYEHN 401 PKL+GVM+HG K Y +N Sbjct: 162 PKLYGVMKHGGKIYTYN 178 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,981,197 Number of Sequences: 219361 Number of extensions: 1345029 Number of successful extensions: 3883 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 3726 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3881 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)