| Clone Name | rbart30f11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HTPX_PICTO (Q6L2Q7) Probable protease htpX homolog (EC 3.4.24.-) | 28 | 6.3 | 2 | R1B16_SOLDE (Q6L400) Putative late blight resistance protein hom... | 28 | 6.3 |
|---|
>HTPX_PICTO (Q6L2Q7) Probable protease htpX homolog (EC 3.4.24.-)| Length = 307 Score = 28.1 bits (61), Expect = 6.3 Identities = 10/35 (28%), Positives = 22/35 (62%) Frame = +3 Query: 6 YIRLLDLIEWLTVKYFLWDTRTLEQMASQSQHTHL 110 ++ +D+I+WL Y + T L++++ SQ+ +L Sbjct: 49 FVLFIDIIQWLVSPYIIGMTYRLQKVSPMSQYGYL 83
>R1B16_SOLDE (Q6L400) Putative late blight resistance protein homolog R1B-16| Length = 1284 Score = 28.1 bits (61), Expect = 6.3 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +1 Query: 112 EYLLDSCIATEMNHYRIAGW 171 EY++D+CI + H+R+ GW Sbjct: 474 EYVVDACINKGIPHWRLKGW 493 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,860,552 Number of Sequences: 219361 Number of extensions: 525773 Number of successful extensions: 960 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 946 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 960 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)