| Clone Name | rbart30e10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DHX33_HUMAN (Q9H6R0) Putative ATP-dependent RNA helicase DHX33 (... | 28 | 9.7 | 2 | MYCN_HUMAN (P04198) N-myc proto-oncogene protein | 28 | 9.7 |
|---|
>DHX33_HUMAN (Q9H6R0) Putative ATP-dependent RNA helicase DHX33 (EC 3.6.1.-)| (DEAH box protein 33) Length = 707 Score = 28.5 bits (62), Expect = 9.7 Identities = 17/41 (41%), Positives = 19/41 (46%), Gaps = 5/41 (12%) Frame = +1 Query: 322 PPLRDSVTQEDAGDGGAG-----RSSPPLRRPRAVPWRAGV 429 PP R V AG GG G R PPL +P A P+ V Sbjct: 27 PPGRQVVMLLTAGSGGRGGGGGRRQQPPLAQPSASPYPEAV 67
>MYCN_HUMAN (P04198) N-myc proto-oncogene protein| Length = 464 Score = 28.5 bits (62), Expect = 9.7 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -3 Query: 426 ASAPRHGPRAAEGRG*PASAAVPGV 352 ASAP GP A G G A A PGV Sbjct: 210 ASAPAAGPAVASGAGIAAPAGAPGV 234 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,867,355 Number of Sequences: 219361 Number of extensions: 741974 Number of successful extensions: 1895 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1826 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1895 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)