| Clone Name | rbart30d03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UFD4_YEAST (P33202) Ubiquitin fusion degradation protein 4 (UB f... | 30 | 5.3 | 2 | PRIM_CHLMU (Q9PLC9) DNA primase (EC 2.7.7.-) | 29 | 7.0 | 3 | PDR1_YEAST (P12383) Transcription factor PDR1 (Pleiotropic drug ... | 29 | 9.1 | 4 | TM50B_PONPY (Q5R4C3) Transmembrane protein 50B | 29 | 9.1 | 5 | TM50B_MOUSE (Q9D1X9) Transmembrane protein 50B | 29 | 9.1 | 6 | TM50B_HUMAN (P56557) Transmembrane protein 50B (HCV p7-transregu... | 29 | 9.1 |
|---|
>UFD4_YEAST (P33202) Ubiquitin fusion degradation protein 4 (UB fusion protein| 4) Length = 1483 Score = 29.6 bits (65), Expect = 5.3 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -3 Query: 398 QHPCGETLKRVFEFINDEKASALESKIKKQRVSEL 294 QHP G TL + I + ES + +R+S+L Sbjct: 141 QHPVGRTLPEILSMIGGRMERSAESSARNERISKL 175
>PRIM_CHLMU (Q9PLC9) DNA primase (EC 2.7.7.-)| Length = 600 Score = 29.3 bits (64), Expect = 7.0 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 6/71 (8%) Frame = +3 Query: 231 QQSYKYVGHLLFCVSSAHLHPQLRYSLLLDLGFQSR-CLLIINE-----LKYSLQCLPTW 392 QQ Y + +LF H+ ++ G S+ CL IN+ +Y L CLP Sbjct: 75 QQGYSFSEAVLFLAKKFHVDLVIKTKTKESSGQDSKECLRRINKEAERFFQYCLLCLPEG 134 Query: 393 MLGLDLLHKRG 425 L L+KRG Sbjct: 135 GEALSYLYKRG 145
>PDR1_YEAST (P12383) Transcription factor PDR1 (Pleiotropic drug resistance| protein 1) Length = 1063 Score = 28.9 bits (63), Expect = 9.1 Identities = 19/70 (27%), Positives = 30/70 (42%), Gaps = 3/70 (4%) Frame = -1 Query: 505 DEKMDTDANVKGTRKGFDELQKLYPNLPLLWRRSRPSIHVGRH*REYLSSLMMRRHLL-- 332 D K D D N G + E Q +L + + H+G H + S+ ++ L Sbjct: 146 DGKNDDDVNRNGFYEDDSESQATLTSLQTTLKNLKEMAHLGTHVTSAIESIELQISDLLK 205 Query: 331 -WNPRSRSKE 305 W P+ R+KE Sbjct: 206 RWEPKVRTKE 215
>TM50B_PONPY (Q5R4C3) Transmembrane protein 50B| Length = 158 Score = 28.9 bits (63), Expect = 9.1 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -3 Query: 122 ATVVAGYYFVYGWWWSADSYCLMPVP 45 A+VVAG F GWW D+ + P P Sbjct: 26 ASVVAGILFFTGWWIMIDAAVVYPKP 51
>TM50B_MOUSE (Q9D1X9) Transmembrane protein 50B| Length = 158 Score = 28.9 bits (63), Expect = 9.1 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -3 Query: 122 ATVVAGYYFVYGWWWSADSYCLMPVP 45 A+VVAG F GWW D+ + P P Sbjct: 26 ASVVAGILFFTGWWIMIDAAVVYPKP 51
>TM50B_HUMAN (P56557) Transmembrane protein 50B (HCV p7-transregulated protein| 3) Length = 158 Score = 28.9 bits (63), Expect = 9.1 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -3 Query: 122 ATVVAGYYFVYGWWWSADSYCLMPVP 45 A+VVAG F GWW D+ + P P Sbjct: 26 ASVVAGILFFTGWWIMIDAAVVYPKP 51 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,427,611 Number of Sequences: 219361 Number of extensions: 1629708 Number of successful extensions: 4404 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4266 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4402 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4027872870 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)