ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart30d01 |
|---|---|
| Clone Library Name | barley_pub |
>TIP11_ORYSA (P50156) Probable aquaporin TIP1.1 (Tonoplast intrinsic protein| 1.1) (OsTIP1.1) (rTIP1) Length = 250 Score = 32.0 bits (71), Expect = 0.42 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 284 FISRTHEQLPTTDY 243 FIS THEQLPTTDY Sbjct: 237 FISHTHEQLPTTDY 250
>S26A1_MOUSE (P58735) Sulfate anion transporter 1 (SAT-1) (Solute carrier family| 26 member 1) Length = 704 Score = 31.2 bits (69), Expect = 0.71 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +2 Query: 32 GRIHRFYTSKLTGSIVTGFTAPQTDGP 112 G++H + S++ G+I TGF APQ P Sbjct: 314 GQLHTRFDSRVAGNIPTGFVAPQVPDP 340
>TIP11_ARATH (P25818) Aquaporin TIP1.1 (Tonoplast intrinsic protein 1.1)| (Gamma-tonoplast intrinsic protein) (Gamma-TIP) (Aquaporin-TIP) (Tonoplast intrinsic protein, root-specific RB7) Length = 251 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 284 FISRTHEQLPTTDY 243 FI+ THEQLPTTDY Sbjct: 238 FINTTHEQLPTTDY 251
>TIP1_MEDTR (Q9FY14) Probable aquaporin TIP-type (MtAQP1)| Length = 250 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 284 FISRTHEQLPTTDY 243 FI+ THEQLPTTDY Sbjct: 237 FINSTHEQLPTTDY 250
>TIP1_MEDSA (P42067) Probable aquaporin TIP-type (Membrane channel protein 1)| (MsMCP1) Length = 249 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 284 FISRTHEQLPTTDY 243 FI+ THEQLPTTDY Sbjct: 236 FINSTHEQLPTTDY 249
>S26A1_RAT (P45380) Sulfate anion transporter 1 (SAT-1) (Solute carrier family| 26 member 1) (Canalicular sulfate transporter) (Sulfate/carbonate antiporter) Length = 703 Score = 29.6 bits (65), Expect = 2.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 32 GRIHRFYTSKLTGSIVTGFTAPQTDGP 112 G++H + S + G+I TGF APQ P Sbjct: 313 GQLHTRFGSSVAGNIPTGFVAPQIPDP 339
>POLG_TMEVG (P08545) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2303 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -1 Query: 223 PPPARPSVWSIASPLASSHESFKFALN 143 PPPA P+V PL ++E F FA N Sbjct: 1180 PPPACPNVMQPQGPLREANEGFTFAKN 1206
>POLG_TMEVB (P08544) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2303 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -1 Query: 223 PPPARPSVWSIASPLASSHESFKFALN 143 PPPA P+V PL ++E F FA N Sbjct: 1180 PPPACPNVMQPQGPLREANEGFTFAKN 1206
>SYE_SULTO (Q971D0) Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA| ligase) (GluRS) Length = 566 Score = 28.5 bits (62), Expect = 4.6 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +2 Query: 59 KLTGSIVTGFTAPQTDGPIDPGNGMDSFIQSKLKRLMTG 175 K+ G VT F AP DGPI GN + I K + G Sbjct: 94 KVEGKFVTRF-APNPDGPIHLGNARAAIISYKYAEMYKG 131
>PAFA2_HUMAN (Q99487) Platelet-activating factor acetylhydrolase 2, cytoplasmic| (EC 3.1.1.47) (Serine-dependent phospholipase A2) (HSD-PLA2) Length = 392 Score = 28.5 bits (62), Expect = 4.6 Identities = 13/44 (29%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = +2 Query: 32 GRIHRFYT--SKLTGSIVTGFTAPQTDGPIDPGNGMDSFIQSKL 157 G +HR T + +TG+++ F + +T G +DP G + +++ L Sbjct: 311 GSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMVRAML 354
>PGBM_MOUSE (Q05793) Basement membrane-specific heparan sulfate proteoglycan core| protein precursor (HSPG) (Perlecan) (PLC) Length = 3707 Score = 28.5 bits (62), Expect = 4.6 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 12/37 (32%) Frame = -1 Query: 91 CETCDDRPCQ------------FTCVKPVNSSARVIS 17 C TC DRPCQ +TCV P +A ++ Sbjct: 3163 CPTCQDRPCQNGGQCQDSESSSYTCVCPAGFTAAAVN 3199
>S26A1_HUMAN (Q9H2B4) Sulfate anion transporter 1 (SAT-1) (Solute carrier family| 26 member 1) Length = 701 Score = 28.1 bits (61), Expect = 6.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 Query: 32 GRIHRFYTSKLTGSIVTGFTAPQTDGP 112 G++H+ + S + G I TGF PQ P Sbjct: 309 GQLHKRFGSSVAGDIPTGFMPPQVPEP 335
>RECK_MOUSE (Q9Z0J1) Reversion-inducing cysteine-rich protein with Kazal motifs| precursor (mRECK) Length = 971 Score = 27.7 bits (60), Expect = 7.9 Identities = 13/55 (23%), Positives = 23/55 (41%) Frame = -1 Query: 217 PARPSVWSIASPLASSHESFKFALNE*IHPIPRVDRSISLWCCETCDDRPCQFTC 53 P + ++ + AS +N P + + SL+CC+ +D CQ C Sbjct: 175 PGPSQIKAVENYCASISPQLIHCVNNYTQSYPMRNPTDSLYCCDRAEDHACQNAC 229
>RECK_HUMAN (O95980) Reversion-inducing cysteine-rich protein with Kazal motifs| precursor (hRECK) (Suppressor of tumorigenicity 15) (ST15) Length = 971 Score = 27.7 bits (60), Expect = 7.9 Identities = 13/55 (23%), Positives = 23/55 (41%) Frame = -1 Query: 217 PARPSVWSIASPLASSHESFKFALNE*IHPIPRVDRSISLWCCETCDDRPCQFTC 53 P + ++ + AS +N P + + SL+CC+ +D CQ C Sbjct: 175 PGPSQIKAVENYCASISPQLIHCVNNYTQSYPMRNPTDSLYCCDRAEDHACQNAC 229
>POLG_TMEVD (P13899) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2301 Score = 27.7 bits (60), Expect = 7.9 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -1 Query: 223 PPPARPSVWSIASPLASSHESFKFALN 143 PPP P+V PL ++E F FA N Sbjct: 1178 PPPVCPNVLQPQGPLREANEGFTFAKN 1204
>SYE_SULAC (Q4J8P2) Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA| ligase) (GluRS) Length = 567 Score = 27.7 bits (60), Expect = 7.9 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 62 LTGSIVTGFTAPQTDGPIDPGNGMDSFIQSKLKRLMTG 175 ++G +VT F AP DGP+ GN + I + R+ G Sbjct: 96 VSGVLVTRF-APNPDGPLHLGNARAAIISHEYARIYNG 132
>HMP_ERWCT (Q6D245) Flavohemoprotein (Hemoglobin-like protein)| (Flavohemoglobin) (Nitric oxide dioxygenase) (EC 1.14.12.17) (NO oxygenase) (NOD) Length = 396 Score = 27.7 bits (60), Expect = 7.9 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = +2 Query: 14 T*NYSGGRIHRFYTSKLTGSIVTGFTAPQTDG-PI---DPGNGMDSFIQ 148 T +SG R R +L S++T FT TDG PI PG + +I+ Sbjct: 146 TGGWSGVRPFRIVNKQLQSSVITSFTLEPTDGQPIADFQPGQYLAIYIK 194 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,271,682 Number of Sequences: 219361 Number of extensions: 621424 Number of successful extensions: 1891 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1840 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1891 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
