Clone Name | rbart29g09 |
---|---|
Clone Library Name | barley_pub |
>GSTU6_ORYSA (Q06398) Probable glutathione S-transferase GSTU6 (EC 2.5.1.18) (28| kDa cold-induced protein) Length = 236 Score = 37.4 bits (85), Expect = 0.024 Identities = 19/33 (57%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = -3 Query: 508 AATPLLAAWAERFRALHGVKEVMP-DPQRLLEY 413 A TP LAAW ERFRA K V+P D +LLE+ Sbjct: 191 ARTPALAAWEERFRATDAAKGVVPDDADKLLEF 223
>GSTX2_MAIZE (P50472) Probable glutathione S-transferase BZ2 (EC 2.5.1.18)| (Protein bronze-2) Length = 236 Score = 35.4 bits (80), Expect = 0.090 Identities = 13/32 (40%), Positives = 23/32 (71%) Frame = -3 Query: 508 AATPLLAAWAERFRALHGVKEVMPDPQRLLEY 413 +ATPLL W++RF A K V+PD ++++++ Sbjct: 190 SATPLLDGWSQRFAAHPAAKRVLPDTEKVVQF 221
>DDX1_DROME (Q9VNV3) ATP-dependent RNA helicase Ddx1 (EC 3.6.1.-) (DEAD box| protein 1) Length = 727 Score = 30.0 bits (66), Expect = 3.8 Identities = 16/59 (27%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = +2 Query: 62 QTQHMMLSISVPRMLQQRISTRTPLGTNGIH---*ITPVHH*GQTVFTKLRMLR*RKCI 229 +T H ++ + P+M S R P+GT+G+H + P +H +T+ +++L+ C+ Sbjct: 439 ETVHHVVCLVDPQMDTTWQSLRQPIGTDGVHDRDNVHPGNHSKETLSQAVKLLKGEYCV 497
>GSTXC_TOBAC (P49332) Probable glutathione S-transferase parC (EC 2.5.1.18)| (Auxin-regulated protein parC) Length = 221 Score = 30.0 bits (66), Expect = 3.8 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = -3 Query: 508 AATPLLAAWAERFRALHGVKEVMPDPQRLLEYNLMRRARLGL 383 A P AWA+R V + +PD ++LE+ + R + GL Sbjct: 179 AECPKFVAWAKRCMQRESVAKSLPDQPKVLEFVKVLRQKFGL 220
>GSTX4_TOBAC (Q03666) Probable glutathione S-transferase (EC 2.5.1.18)| (Auxin-induced protein PCNT107) Length = 221 Score = 30.0 bits (66), Expect = 3.8 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = -3 Query: 508 AATPLLAAWAERFRALHGVKEVMPDPQRLLEYNLMRRARLGL 383 A P AWA+R V + +PD ++LE+ + R + GL Sbjct: 179 AECPKFVAWAKRCMQRESVAKSLPDQPKVLEFVKVLRQKFGL 220 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,783,310 Number of Sequences: 219361 Number of extensions: 1133458 Number of successful extensions: 2622 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2619 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3754426130 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)