| Clone Name | rbart29f08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VND_DROME (P22808) Homeobox protein vnd (Protein ventral nervous... | 32 | 0.71 | 2 | VATC_DROME (Q9V7N5) Vacuolar ATP synthase subunit C (EC 3.6.3.14... | 29 | 6.0 | 3 | CCR4_MOUSE (P51680) C-C chemokine receptor type 4 (C-C CKR-4) (C... | 29 | 6.0 |
|---|
>VND_DROME (P22808) Homeobox protein vnd (Protein ventral nervous system| defective) (Homeobox protein NK-2) Length = 723 Score = 32.3 bits (72), Expect = 0.71 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +3 Query: 36 QQEGPRREDHHLPLLYQKQQHRNNAHAPTP 125 QQ+ P + HH P L QQH A AP P Sbjct: 295 QQQHPHHQQHHHPHLLLPQQHHQQAVAPLP 324
>VATC_DROME (Q9V7N5) Vacuolar ATP synthase subunit C (EC 3.6.3.14) (V-ATPase C| subunit) (Vacuolar proton pump C subunit) Length = 714 Score = 29.3 bits (64), Expect = 6.0 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 6/36 (16%) Frame = +3 Query: 156 TCIDTYNTSNNLFSPE------YAFHIPSY*IYFLD 245 TC TY+T NNL S + Y FHIP + LD Sbjct: 15 TCQQTYDTMNNLTSKQHNLCNNYKFHIPDLKVGTLD 50
>CCR4_MOUSE (P51680) C-C chemokine receptor type 4 (C-C CKR-4) (CC-CKR-4)| (CCR-4) (CCR4) Length = 360 Score = 29.3 bits (64), Expect = 6.0 Identities = 25/92 (27%), Positives = 40/92 (43%) Frame = -3 Query: 308 WGFCVILTALFFLGGPSLMEIIQEIYLVGWYMEGVFRGK*VVASVVRIYTCICFXXXXXX 129 WG+ +F LG L +I+ +YLVG+Y G+F ++ + Y I Sbjct: 95 WGYYAADQWVFGLG---LCKIVSWMYLVGFY-SGIFF---IMLMSIDRYLAIVHAVFSLK 147 Query: 128 XXXXRMCVVAVLLFLVEQWKMMIFASWPLLLY 33 V+ L+ W + +FAS P LL+ Sbjct: 148 ARTLTYGVITSLI----TWSVAVFASLPGLLF 175 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,125,125 Number of Sequences: 219361 Number of extensions: 1167732 Number of successful extensions: 3560 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3481 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3559 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)