| Clone Name | rbart29f07 |
|---|---|
| Clone Library Name | barley_pub |
>YKJ4_YEAST (P28321) Hypothetical 35.5 kDa protein in CWP1-MBR1 intergenic| region Length = 313 Score = 39.7 bits (91), Expect = 0.003 Identities = 18/40 (45%), Positives = 26/40 (65%) Frame = -1 Query: 438 SQDKKLNLYPGMWHALTSGESPENIHIVFQDIIAWLDQRS 319 S DK+L LYPG H++ S E+ E + VF D+ WLD+ + Sbjct: 268 SADKELKLYPGARHSIFSLETDEVFNTVFNDMKQWLDKHT 307
>MGLL_HUMAN (Q99685) Monoglyceride lipase (EC 3.1.1.23) (MGL) (HU-K5)| (Lysophospholipase homolog) (Lysophospholipase-like) Length = 303 Score = 36.6 bits (83), Expect = 0.028 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 444 AVSQDKKLNLYPGMWHALTSGESPENIHIVFQDIIAWLDQRS 319 A SQDK L +Y G +H L E PE + VF +I W+ QR+ Sbjct: 254 AKSQDKTLKIYEGAYHVLHK-ELPEVTNSVFHEINMWVSQRT 294
>PHF2_HUMAN (O75151) PHD finger protein 2 (GRC5)| Length = 1101 Score = 33.1 bits (74), Expect = 0.31 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 437 ARTRSSTSTPACGTPSPPARAPKTSTSFSKISSRGSTKGHSP 312 A T S+++TPA TP+ A T S S SS+ S +G SP Sbjct: 974 AGTTSTSTTPASTTPASTTPASTTPASTSTASSQASQEGSSP 1015
>VIT2_CHICK (P02845) Vitellogenin-2 precursor (Vitellogenin II) (Major| vitellogenin) [Contains: Lipovitellin-1 (Lipovitellin I) (LVI); Phosvitin (PV); Lipovitellin-2 (Lipovitellin II) (LVII); YGP40] Length = 1850 Score = 32.7 bits (73), Expect = 0.41 Identities = 18/60 (30%), Positives = 30/60 (50%) Frame = -2 Query: 437 ARTRSSTSTPACGTPSPPARAPKTSTSFSKISSRGSTKGHSPNHHXXXXXXXXXXRWSGR 258 +R+RSS+ + + + S + + K+S+S S SS S+ HS +HH S R Sbjct: 1231 SRSRSSSKSSSSSSSSSSSSSSKSSSSRSSSSSSKSSSHHSHSHHSGHLNGSSSSSSSSR 1290
>PHF2_MOUSE (Q9WTU0) PHD finger protein 2 (GRC5)| Length = 1096 Score = 32.3 bits (72), Expect = 0.53 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = -2 Query: 431 TRSSTSTPACGTPSPPARAPKTSTSFSKISSRGSTKGHSP 312 T S+++TPA TP+ A T S S SS+ S +G SP Sbjct: 972 TTSASTTPASTTPASTTPASTTPASTSTASSQASQEGSSP 1011
>VE4_HPV57 (P22157) Probable protein E4| Length = 124 Score = 32.3 bits (72), Expect = 0.53 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 436 PGQEAQPLPRHVARPHLRREPRKHPHRFP 350 P + QP P+ +RPH R PR+H R P Sbjct: 44 PQSQPQPQPQQQSRPHSRTPPRRHRVRHP 72
>MGLL_RAT (Q8R431) Monoglyceride lipase (EC 3.1.1.23) (MGL)| Length = 303 Score = 31.6 bits (70), Expect = 0.91 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = -1 Query: 438 SQDKKLNLYPGMWHALTSGESPENIHIVFQDIIAWLDQR 322 SQDK L +Y G +H L E PE + V +I W+ R Sbjct: 256 SQDKTLKMYEGAYHVLHK-ELPEVTNSVLHEINTWVSHR 293
>BARH1_DROAN (P22544) Homeobox protein B-H1 (Homeobox BarH1 protein)| Length = 606 Score = 31.2 bits (69), Expect = 1.2 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = -3 Query: 433 GQEAQPLPRHVARPHLRREPRKHPHRFPRYHRVARP 326 G A P P H P P HPH P H + P Sbjct: 157 GAAAPPPPLHHLHPQSHPHPHPHPHSHPHPHALVHP 192
>MAGB1_HUMAN (P43366) Melanoma-associated antigen B1 (MAGE-B1 antigen) (MAGE-XP| antigen) (DSS-AHC critical interval MAGE superfamily 10) (DAM10) Length = 347 Score = 31.2 bits (69), Expect = 1.2 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -2 Query: 419 TSTPACGTPSPPARAPKTSTSFSKISSRGSTKG 321 TS+PA G P P AP T+T+ + +S S +G Sbjct: 50 TSSPAAGIPQKPQGAPPTTTAAAAVSCTESDEG 82
>MGLL_MOUSE (O35678) Monoglyceride lipase (EC 3.1.1.23) (MGL)| Length = 303 Score = 31.2 bits (69), Expect = 1.2 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -1 Query: 438 SQDKKLNLYPGMWHALTSGESPENIHIVFQDIIAWLDQR 322 SQDK L +Y G +H L E PE + V ++ +W+ R Sbjct: 256 SQDKTLKMYEGAYHVL-HRELPEVTNSVLHEVNSWVSHR 293
>MUCDL_RAT (Q9JIK1) Mucin and cadherin-like protein precursor| (Mu-protocadherin) (GP100) Length = 862 Score = 30.0 bits (66), Expect = 2.7 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = -2 Query: 425 SSTSTPACGTPSPPARAPKTSTSFSKISSRGSTKGHSP 312 SST TP GT P P STS + GST+ P Sbjct: 605 SSTQTPRPGTSQPMVPTPGASTSSQPATPSGSTQTPKP 642
>MAGB2_HUMAN (O15479) Melanoma-associated antigen B2 (MAGE-B2 antigen) (DSS-AHC| critical interval MAGE superfamily 6) (DAM6) (MAGE XP-2) Length = 319 Score = 30.0 bits (66), Expect = 2.7 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = -2 Query: 425 SSTSTPACGTPSPPARAPKTSTSFSK-ISSRGSTKG 321 +++S+PA G P P RAP T+ + + +SS S KG Sbjct: 49 AASSSPAAGIPQKPQRAPTTAAAAAAGVSSTKSKKG 84
>RERE_MOUSE (Q80TZ9) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-2) Length = 1558 Score = 30.0 bits (66), Expect = 2.7 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = -3 Query: 442 SEPGQEAQPLPRHVARPHLRREPRKHPHRFPRYHRVARPKVIP 314 S+P + Q A H+++ P HP R P H +P P Sbjct: 782 SQPPNQTQSTVAPAAHTHIQQAPTLHPPRLPSPHPPLQPMTAP 824
>PHLA1_HUMAN (Q8WV24) Pleckstrin homology-like domain family A member 1 (T-cell| death-associated gene 51 protein) (Apoptosis-associated nuclear protein) (Proline- and histidine-rich protein) (Proline- and glutamine-rich protein) (PQ-rich protein) Length = 259 Score = 29.6 bits (65), Expect = 3.5 Identities = 12/39 (30%), Positives = 15/39 (38%) Frame = -3 Query: 430 QEAQPLPRHVARPHLRREPRKHPHRFPRYHRVARPKVIP 314 Q+ P P PH HPH P H++ P P Sbjct: 204 QQLHPYPHPHPHPHSHPHSHPHPHPHPHPHQIPHPHPQP 242
>PHLA1_MOUSE (Q62392) Pleckstrin homology-like domain family A member 1 (T-cell| death-associated gene 51 protein) (Proline- and glutamine-rich protein) (PQR protein) Length = 261 Score = 29.6 bits (65), Expect = 3.5 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = -3 Query: 439 EPGQEAQPLPRHV-ARPHLRREPRKHPHRFPRYHRVARPKVIP 314 +P + QP P+ + + PH P HPH+ P H P P Sbjct: 190 QPQPQPQPQPQQLHSYPHPHPHPYSHPHQHPHPHPHPHPHPHP 232
>KAPR_USTMA (P49605) cAMP-dependent protein kinase regulatory subunit (PKA| regulatory subunit) Length = 522 Score = 29.6 bits (65), Expect = 3.5 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -2 Query: 431 TRSSTSTPACGTPSPPARAPKTSTSFSKISSRGST 327 ++S STPA TP+ PA + FS + GST Sbjct: 117 SQSPDSTPAPATPAAPAAPAAPAAPFSSLGGSGST 151
>YO25_CAEEL (P34675) Hypothetical protein ZK688.5| Length = 1620 Score = 29.3 bits (64), Expect = 4.5 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -2 Query: 422 STSTPACGTPSPPARAPKTSTSFSKISS 339 S+ PA TPSPPA P+T+++ + + S Sbjct: 969 SSDQPARSTPSPPAPTPRTTSAPATVQS 996
>CREB5_MOUSE (Q8K1L0) cAMP response element-binding protein 5 (CRE-BPa)| (Fragment) Length = 353 Score = 29.3 bits (64), Expect = 4.5 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -3 Query: 442 SEPGQEAQPLPRHVARPHLRREPRKHPHRFPRYHR 338 S P Q Q LP H PH + P HPH P + + Sbjct: 121 SHPHQH-QTLPPHHPYPHQHQHPAHHPHPQPHHQQ 154
>PITM2_MOUSE (Q6ZPQ6) Membrane-associated phosphatidylinositol transfer protein| 2 (Phosphatidylinositol transfer protein, membrane-associated 2) (Pyk2 N-terminal domain-interacting receptor 3) (NIR-3) (Drosophila retinal degeneration B homolog 2) (RdgB2) Length = 1335 Score = 29.3 bits (64), Expect = 4.5 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = -2 Query: 422 STSTPACGTPSPPARAPKTSTSFSKISSRGSTKGHSPNHH 303 +TS P P R K S S SSR S +G SP+ H Sbjct: 281 TTSDPGSKNGEPLGRGLKKQWSTSSKSSRSSKRGASPSRH 320
>ADRM1_RAT (Q9JMB5) Adhesion-regulating molecule 1 precursor (110 kDa cell| membrane glycoprotein) (Gp110) Length = 407 Score = 29.3 bits (64), Expect = 4.5 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -2 Query: 437 ARTRSSTSTPACGTPSP--PARAPKTSTSFSKISSRGSTKGHSP 312 A T SST++ A TP+P PA A TS S + S G++ SP Sbjct: 215 AVTPSSTTSSARATPAPSAPAAASATSPSPAPSSGNGTSTAASP 258
>CREB5_HUMAN (Q02930) cAMP response element-binding protein 5 (CRE-BPa)| Length = 508 Score = 29.3 bits (64), Expect = 4.5 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -3 Query: 442 SEPGQEAQPLPRHVARPHLRREPRKHPHRFPRYHR 338 S P Q Q LP H PH + P HPH P + + Sbjct: 276 SHPHQH-QTLPPHHPYPHQHQHPAHHPHPQPHHQQ 309
>SLOU_DROME (P22807) Homeobox protein slou (S59/2) (Protein slouch) (Homeobox| protein NK-1) Length = 659 Score = 28.9 bits (63), Expect = 5.9 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -3 Query: 409 RHVARPHLRREPRKHPHRFPRYH 341 +H A PH + P HPH P H Sbjct: 211 QHPAHPHSHQHPHPHPHPHPHPH 233
>ICK_MOUSE (Q9JKV2) Serine/threonine-protein kinase ICK (EC 2.7.11.22)| (Intestinal cell kinase) (mICK) (MAK-related kinase) (MRK) Length = 629 Score = 28.9 bits (63), Expect = 5.9 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = -2 Query: 428 RSSTSTPACGTPSPPARAPKTSTSFSKISSRGSTKGHSPNH 306 + T P P+PPA+AP + +++ ISSR S P H Sbjct: 305 QDKTGPPPYIKPAPPAQAP--AKAYTLISSRPSQASQPPQH 343
>CF122_HUMAN (Q5T6M2) Protein C6orf122| Length = 205 Score = 28.9 bits (63), Expect = 5.9 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -2 Query: 434 RTRSSTSTPACGTPSPPARAPKT--STSFSKISSRGSTKGHSP 312 R S+ P CGT S R PK+ SFS S + T+ SP Sbjct: 127 RQHSTGRKPHCGTRSAAPRNPKSIHKRSFSAKSLKNKTRNESP 169
>DYHC_PARTE (Q27171) Dynein heavy chain, cytosolic (DYHC) (DHC08)| Length = 4540 Score = 28.5 bits (62), Expect = 7.7 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -2 Query: 269 WSGRPSTMSRISTNKIAQKLMT 204 WSG PS + R+ +++ QKL+T Sbjct: 4221 WSGLPSNVERVQRDQLTQKLIT 4242 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,138,498 Number of Sequences: 219361 Number of extensions: 1121236 Number of successful extensions: 3949 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 3581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3925 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)