Clone Name | rbart29e09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DNAJ_VIBF1 (Q5E3A8) Chaperone protein dnaJ | 28 | 5.6 | 2 | YAB9_SCHPO (Q09809) Hypothetical protein C2G11.09 in chromosome I | 28 | 7.4 |
---|
>DNAJ_VIBF1 (Q5E3A8) Chaperone protein dnaJ| Length = 379 Score = 28.1 bits (61), Expect = 5.6 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = -1 Query: 166 ASAPMSVLFGENLSQLINKHFFYLRRACPTAFLFAQIIF*FCNSCY 29 +S S G+ Q+ + FF +++ACPT +II CNSC+ Sbjct: 160 SSTTCSTCHGQGQVQM-RQGFFAVQQACPTCHGKGKIIKDPCNSCH 204
>YAB9_SCHPO (Q09809) Hypothetical protein C2G11.09 in chromosome I| Length = 796 Score = 27.7 bits (60), Expect = 7.4 Identities = 16/53 (30%), Positives = 22/53 (41%) Frame = -1 Query: 253 DFRLSFWLL*SSRPGYCYFE*TISFRWFAASAPMSVLFGENLSQLINKHFFYL 95 D R FWL C F RW AP + + G NL L + ++ +L Sbjct: 23 DLRTQFWLAFLLGASACVFFCFFRKRWKVLYAPRTTIEGLNLPTLSSSYYKWL 75 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,596,723 Number of Sequences: 219361 Number of extensions: 640690 Number of successful extensions: 1417 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1417 length of database: 80,573,946 effective HSP length: 89 effective length of database: 61,050,817 effective search space used: 1465219608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)