Clone Name | rbart29d01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SIF1_DROME (P91621) Protein still life, isoform SIF type 1 | 28 | 9.2 | 2 | SIF2_DROME (P91620) Protein still life, isoforms C/SIF type 2 | 28 | 9.2 |
---|
>SIF1_DROME (P91621) Protein still life, isoform SIF type 1| Length = 2072 Score = 27.7 bits (60), Expect = 9.2 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -3 Query: 107 KKARSIHEGNALCFKYPCSVVYLCVLRMNKKSAL 6 KK +H A+CF + +VV+LC R+ +K L Sbjct: 1682 KKGLELH---AMCFVFKSAVVFLCKERLRQKKKL 1712
>SIF2_DROME (P91620) Protein still life, isoforms C/SIF type 2| Length = 2061 Score = 27.7 bits (60), Expect = 9.2 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -3 Query: 107 KKARSIHEGNALCFKYPCSVVYLCVLRMNKKSAL 6 KK +H A+CF + +VV+LC R+ +K L Sbjct: 1671 KKGLELH---AMCFVFKSAVVFLCKERLRQKKKL 1701 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,862,694 Number of Sequences: 219361 Number of extensions: 204107 Number of successful extensions: 301 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 301 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 301 length of database: 80,573,946 effective HSP length: 20 effective length of database: 76,186,726 effective search space used: 1828481424 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)