Clone Name | rbart29b02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YB92_YEAST (P38331) Hypothetical 27.6 kDa protein in THI2-ALG7 i... | 39 | 0.012 | 2 | YGK1_YEAST (P53144) Hypothetical 25.3 kDa protein in RPL28-SEH1 ... | 34 | 0.23 |
---|
>YB92_YEAST (P38331) Hypothetical 27.6 kDa protein in THI2-ALG7 intergenic| region Length = 238 Score = 38.5 bits (88), Expect = 0.012 Identities = 21/53 (39%), Positives = 33/53 (62%), Gaps = 2/53 (3%) Frame = -2 Query: 539 VKDFDKVEMILQALEYEKEH--GKVLDEFFLSTAGKFQTEIGKSWAAEVNSRR 387 VKD DK EM++Q EYE+E+ K D+FF + A +T+ K W +++ +R Sbjct: 174 VKDIDKYEMLVQCFEYEREYKGTKNFDDFFGAVA-SIKTDEVKGWTSDLVVQR 225
>YGK1_YEAST (P53144) Hypothetical 25.3 kDa protein in RPL28-SEH1 intergenic| region Length = 215 Score = 34.3 bits (77), Expect = 0.23 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = -2 Query: 539 VKDFDKVEMILQALEYE-KEHGKVLDEFFLSTAGKFQTEIGKSW 411 VKD DK EM++Q EYE K +GK + FL +T+ K W Sbjct: 155 VKDIDKYEMLVQCFEYEQKYNGKKDLKQFLGAINDIKTDEVKKW 198 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,649,843 Number of Sequences: 219361 Number of extensions: 1555991 Number of successful extensions: 2892 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2847 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2892 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4315578075 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)