Clone Name | rbart29a10 |
---|---|
Clone Library Name | barley_pub |
>XPO1_RAT (Q80U96) Exportin-1 (Exp1) (Chromosome region maintenance 1 protein| homolog) Length = 1071 Score = 32.3 bits (72), Expect = 0.77 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 5/59 (8%) Frame = -1 Query: 376 HASKRTMDIYLFMNSKVLFKTVR-----KSAQLRKLKPVIVHLNYHPDKEARMKAVIEF 215 HA+++ +D ++ +L V + AQ R + V+ HL HPD R+ ++EF Sbjct: 11 HAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEF 69
>XPO1_MOUSE (Q6P5F9) Exportin-1 (Exp1) (Chromosome region maintenance 1 protein| homolog) Length = 1071 Score = 32.3 bits (72), Expect = 0.77 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 5/59 (8%) Frame = -1 Query: 376 HASKRTMDIYLFMNSKVLFKTVR-----KSAQLRKLKPVIVHLNYHPDKEARMKAVIEF 215 HA+++ +D ++ +L V + AQ R + V+ HL HPD R+ ++EF Sbjct: 11 HAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEF 69
>XPO1_HUMAN (O14980) Exportin-1 (Exp1) (Chromosome region maintenance 1 protein| homolog) Length = 1071 Score = 32.3 bits (72), Expect = 0.77 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 5/59 (8%) Frame = -1 Query: 376 HASKRTMDIYLFMNSKVLFKTVR-----KSAQLRKLKPVIVHLNYHPDKEARMKAVIEF 215 HA+++ +D ++ +L V + AQ R + V+ HL HPD R+ ++EF Sbjct: 11 HAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEF 69
>TOP3_YEAST (P13099) DNA topoisomerase 3 (EC 5.99.1.2) (DNA topoisomerase III)| Length = 656 Score = 29.3 bits (64), Expect = 6.5 Identities = 15/60 (25%), Positives = 23/60 (38%) Frame = +1 Query: 190 VHSAFHEHKTQSLLSCAPPYQDGSSNARSLASTSAVEHFXXXXXXXXXXXXXDIYPWFFW 369 V +E+ + L+C +D + +L AVE F D+YPW W Sbjct: 441 VERRVYEYVARHFLACCS--EDAKGQSMTLVLDWAVERFSASGLVVLERNFLDVYPWARW 498
>YOS1_SCHPO (P87319) Hypothetical protein C21C3.01c in chromosome II| Length = 3011 Score = 28.9 bits (63), Expect = 8.5 Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 4/43 (9%) Frame = -2 Query: 408 FSPHILVMK----VYMHPKEPWIYISL*TAKFSSRQ*GKVLNC 292 FSP+I++ K +++ PK + IS +A SS + GKV+ C Sbjct: 2147 FSPYIIINKSGSFLFVGPKNDYNRISFSSASLSSGEDGKVVPC 2189 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,973,718 Number of Sequences: 219361 Number of extensions: 1447671 Number of successful extensions: 3683 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3628 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3682 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3754426130 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)