Clone Name | rbart29a07 |
---|---|
Clone Library Name | barley_pub |
>PAP2_HUMAN (Q9BXP8) Pappalysin-2 precursor (EC 3.4.24.-) (Pregnancy-associated| plasma protein-A2) (PAPP-A2) (Pregnancy-associated plasma protein-E1) (PAPP-E) Length = 1791 Score = 32.0 bits (71), Expect = 0.38 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = -2 Query: 355 DHGRRRLRVQALLRGRRRLTHPSPIILHCVAS 260 +H ++VQ+++ RR HP P+++HC+ S Sbjct: 1701 EHWMEPVKVQSIVCTGRRQWHPDPVLVHCIQS 1732
>NPHP3_XENLA (Q6AZT7) Nephrocystin-3| Length = 1300 Score = 30.0 bits (66), Expect = 1.5 Identities = 20/60 (33%), Positives = 28/60 (46%) Frame = +3 Query: 105 KNNDTMYQCTNMNQSVQLIRLSDISHSCSVSYTAKEYIFLTEILKFRRPSWTDATQCRMM 284 K D + QC +V L RL + V +AKE F+ EIL F S ++C +M Sbjct: 702 KIEDVLQQCLQCQDTVSLYRLV-LRSVQEVMPSAKEKEFMREILCFISVSHNGVSECELM 760
>RPO2_FOWPV (Q9J544) DNA-directed RNA polymerase 132 kDa polypeptide (EC 2.7.7.6)| Length = 1161 Score = 29.6 bits (65), Expect = 1.9 Identities = 21/85 (24%), Positives = 33/85 (38%) Frame = +3 Query: 36 RCTRKRGRKLEQSTKATKRQGGYKNNDTMYQCTNMNQSVQLIRLSDISHSCSVSYTAKEY 215 RC K+ + + Q+ + KR GG I+ ++ C +++ A Sbjct: 1021 RCRGKKTKLIRQANEGRKRGGG-------------------IKFGEMERDCLIAHGAANT 1061 Query: 216 IFLTEILKFRRPSWTDATQCRMMGD 290 I TEILK + D C GD Sbjct: 1062 I--TEILKDSEEDYQDVYVCENCGD 1084
>SFSA_ARCFU (O28756) Sugar fermentation stimulation protein homolog| Length = 219 Score = 29.3 bits (64), Expect = 2.5 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = +3 Query: 3 RESIMERNKIDRCTRKRGRKLEQSTKATKRQGGYKNNDTMYQ 128 +E I E N + +C KRG KL A +GGY DT Q Sbjct: 43 KELIFEGN-VGKCLTKRGGKLSYRLFAVSCEGGYALIDTQLQ 83
>UQCR2_CANGA (Q6FSJ3) Ubiquinol-cytochrome-c reductase complex core protein 2,| mitochondrial precursor (EC 1.10.2.2) Length = 364 Score = 28.9 bits (63), Expect = 3.2 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +3 Query: 123 YQCTNMNQSVQLIRLSDISHSCSVSYTAKEYIFL-TEILKFRRPSWTDA 266 +Q TN +++L+R S++ C+ S +EYI L LK P + +A Sbjct: 54 FQNTNTKSALRLVRESELLGGCTKSTVDREYITLEARFLKENLPYYVNA 102
>CCNE_HEMPU (O15995) G1/S-specific cyclin-E| Length = 424 Score = 28.1 bits (61), Expect = 5.5 Identities = 20/69 (28%), Positives = 30/69 (43%) Frame = +3 Query: 6 ESIMERNKIDRCTRKRGRKLEQSTKATKRQGGYKNNDTMYQCTNMNQSVQLIRLSDISHS 185 E I + N + CTRKR + + +T +K + + Q T N+ V + S I S Sbjct: 19 ECISDENNLPMCTRKRKTREQDTTGVSKAEEVQRRRQ---QFTIENRWVPISESSSIETS 75 Query: 186 CSVSYTAKE 212 V KE Sbjct: 76 LLVPMQTKE 84
>POLG_DEN3 (P27915) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3390 Score = 27.3 bits (59), Expect = 9.4 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +3 Query: 9 SIMERNKIDRCTRKRGRKLEQSTKATKRQGGYKNNDTMYQCTNMN 143 SI N I C RK G+K+ Q ++ K DT YQ T +N Sbjct: 1838 SIKAGNVIANCLRKNGKKVIQLSR--------KTFDTEYQKTKLN 1874
>TRIM6_HUMAN (Q9C030) Tripartite motif protein 6 (RING finger protein 89)| Length = 488 Score = 27.3 bits (59), Expect = 9.4 Identities = 17/59 (28%), Positives = 28/59 (47%) Frame = +3 Query: 21 RNKIDRCTRKRGRKLEQSTKATKRQGGYKNNDTMYQCTNMNQSVQLIRLSDISHSCSVS 197 RN +DR ++ +KLEQ K R ND ++Q ++ + + SD+ C S Sbjct: 191 RNILDRVEQRELKKLEQEEKKGLRIIEEAENDLVHQTQSLRELI-----SDLERRCQGS 244 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,697,149 Number of Sequences: 219361 Number of extensions: 850568 Number of successful extensions: 2272 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2229 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2272 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)