Clone Name | rbart29a01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CYK3_YEAST (Q07533) Cytokinesis protein 3 | 30 | 3.6 | 2 | CKLF4_MOUSE (Q8CJ61) CKLF-like MARVEL transmembrane domain-conta... | 29 | 6.2 | 3 | YCF19_CYACA (Q9TM45) Hypothetical 10.5 kDa protein ycf19 | 29 | 6.2 |
---|
>CYK3_YEAST (Q07533) Cytokinesis protein 3| Length = 885 Score = 30.0 bits (66), Expect = 3.6 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +2 Query: 179 SSPYVTDTFPSHFLHPQALYLFLSHTQFLNPTYIFRCMFALANYLNRFRS 328 S+ Y+ FPS F + LY F + FL + I+ C + N + F S Sbjct: 634 SALYLPLVFPSFFKNELKLYKFSTALSFLEDSEIYECSLEIPNDVEVFAS 683
>CKLF4_MOUSE (Q8CJ61) CKLF-like MARVEL transmembrane domain-containing protein 4| (Chemokine-like factor superfamily member 4) Length = 208 Score = 29.3 bits (64), Expect = 6.2 Identities = 19/52 (36%), Positives = 32/52 (61%) Frame = -1 Query: 432 LAFIQIFTVVECMRCALSGMYPNVPFISHTAFIHSDLNLFR*LASANMHLKM 277 +AFI I T++EC C G+Y F+S +AF+ + + L L S N+H+++ Sbjct: 67 IAFICIETIMECSPC--EGLY-FFEFVSCSAFVVTGVLLI--LFSLNLHMRI 113
>YCF19_CYACA (Q9TM45) Hypothetical 10.5 kDa protein ycf19| Length = 91 Score = 29.3 bits (64), Expect = 6.2 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 5/46 (10%) Frame = -1 Query: 435 TLAFIQIFTVVECMRCALSGMYPNV-----PFISHTAFIHSDLNLF 313 T+AF+QI+ V+ +R +L G +PN+ PF S + LNLF Sbjct: 12 TIAFLQIYIVLILLRMSL-GWFPNINWYSQPFYSLSQLSDPYLNLF 56 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,349,932 Number of Sequences: 219361 Number of extensions: 1510655 Number of successful extensions: 3218 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3218 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)