| Clone Name | rbart28h06 |
|---|---|
| Clone Library Name | barley_pub |
>CPK15_ARATH (P92937) CBL-interacting serine/threonine-protein kinase 15 (EC| 2.7.11.1) (Serine/threonine-protein kinase ATPK10) (SOS2-like protein kinase PKS3) (SOS-interacting protein 2) (SNF1-related kinase 3.1) Length = 421 Score = 33.9 bits (76), Expect = 0.19 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -3 Query: 444 EVAADVTVVEFAHDGGDALDFNKFCAEDVRPGLADIVWAW 325 E+A +V GGD ++ + E +RP L D V AW Sbjct: 381 EIAPSYHMVVLKKSGGDTAEYKRVMKESIRPALIDFVLAW 420
>ATX2L_MOUSE (Q7TQH0) Ataxin-2-like protein| Length = 1049 Score = 31.6 bits (70), Expect = 0.93 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 11/60 (18%) Frame = +2 Query: 254 AQRTPGGTA*DHATAPG-----------KAGTSPCHAHTMSASPGRTSSAQNLLKSSASP 400 A+R+PGGT+ + PG A SPC +A G A+++L +SA P Sbjct: 24 ARRSPGGTSPPNGGLPGPLTATAAPPGPPAAVSPCLGPAAAAGSGLRRGAESILAASAPP 83
>CIPK1_ORYSA (Q6X4A2) CIPK-like protein 1 (EC 2.7.11.1) (OsCK1)| Length = 449 Score = 30.8 bits (68), Expect = 1.6 Identities = 17/44 (38%), Positives = 23/44 (52%) Frame = -3 Query: 444 EVAADVTVVEFAHDGGDALDFNKFCAEDVRPGLADIVWAWQGDV 313 +VA + VVE GD L+F KF + L D+VW G+V Sbjct: 400 QVAPSLHVVELKKAKGDTLEFQKF-YRTLSTQLKDVVWKCDGEV 442
>CCD16_BRARE (Q6P0I6) Coiled-coil domain-containing protein 16| Length = 326 Score = 30.4 bits (67), Expect = 2.1 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 4/37 (10%) Frame = +2 Query: 305 KAGTSPCH----AHTMSASPGRTSSAQNLLKSSASPP 403 K+ T+P H AHT + +P SS+ + LK +A PP Sbjct: 80 KSRTAPAHTPAPAHTPAHTPAAASSSSSTLKRAAEPP 116
>BISC_ECOLI (P20099) Biotin sulfoxide reductase (EC 1.-.-.-) (BDS reductase)| (BSO reductase) Length = 777 Score = 30.0 bits (66), Expect = 2.7 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = -3 Query: 342 DIVWAWQGDVPALPGAVA*SQAVPPGVLCAYKWRWSKLVILCRIIC 205 D V W L GAV S+ + PGV+C ++ W L + IC Sbjct: 684 DTVRLWNARGQILAGAVI-SEGIKPGVICIHEGAWPDLDLTADGIC 728
>FABH2_STRAW (Q82M29) 3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 2 (EC| 2.3.1.41) (3-oxoacyl-[acyl-carrier-protein] synthase III protein 2) (Beta-ketoacyl-ACP synthase III 2) (KAS III 2) Length = 315 Score = 29.3 bits (64), Expect = 4.6 Identities = 22/81 (27%), Positives = 33/81 (40%), Gaps = 4/81 (4%) Frame = -3 Query: 435 ADVTVVEFAHDGGDALDFNKFCAEDVRPGLADIVWAWQGDVPALPGAVA*SQAVPPGVL- 259 +D T DG A + C E PG+ ++W G VP + AV + PP Sbjct: 150 SDRTTCVLVGDGAGAAVVDA-CPEGAEPGIGPVLW---GSVPEMGHAVR-IEGTPPRFAQ 204 Query: 258 ---CAYKWRWSKLVILCRIIC 205 Y+W ++L + R C Sbjct: 205 EGQSVYRWATTQLPAIARRAC 225
>ATX2L_HUMAN (Q8WWM7) Ataxin-2-like protein (Ataxin-2 domain protein)| (Ataxin-2-related protein) Length = 1075 Score = 28.9 bits (63), Expect = 6.0 Identities = 18/61 (29%), Positives = 24/61 (39%), Gaps = 11/61 (18%) Frame = +2 Query: 254 AQRTPGGTA*DHATAPGKAGTS-----------PCHAHTMSASPGRTSSAQNLLKSSASP 400 A+R PGGT+ + PG TS PC +A G A+ +L P Sbjct: 24 ARRPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLRRGAEGILAPQPPP 83 Query: 401 P 403 P Sbjct: 84 P 84
>MIB2_HUMAN (Q96AX9) Ubiquitin ligase protein MIB2 (EC 6.3.2.-) (Mind bomb| homolog 2) (Zinc finger ZZ type with ankyrin repeat domain protein 1) (Skeletrophin) (Novelzin) (Novel zinc finger protein) (Putative NF-kappa-B-activating protein 002N) Length = 1013 Score = 28.5 bits (62), Expect = 7.9 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -1 Query: 359 CALGSRTLCGRGRATCPPCRAPSRD 285 C G+ CG + CP CR P RD Sbjct: 983 CGHGACAPCGSALSACPICRQPIRD 1007 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,920,091 Number of Sequences: 219361 Number of extensions: 1122915 Number of successful extensions: 3068 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3010 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3066 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)