| Clone Name | rbart28g11 |
|---|---|
| Clone Library Name | barley_pub |
>ZRP4_MAIZE (P47917) O-methyltransferase ZRP4 (EC 2.1.1.-) (OMT)| Length = 364 Score = 55.5 bits (132), Expect = 9e-08 Identities = 21/42 (50%), Positives = 32/42 (76%) Frame = -2 Query: 521 MVMTNGRQRDETDWSEIFIKAGFSDYKVVKKLGARGVFEVYP 396 ++ NG +RDE +WS+IF +AG+SDY+++ LG R + EVYP Sbjct: 323 IMFINGMERDEQEWSKIFSEAGYSDYRIIPVLGVRSIIEVYP 364
>7OMT9_MEDSA (O22309) Isoflavone-7-O-methytransferase 9 (EC 2.1.1.150)| (Isoflavone-O-methytransferase 9) (7 IOMT-9) Length = 352 Score = 45.1 bits (105), Expect = 1e-04 Identities = 17/42 (40%), Positives = 27/42 (64%) Frame = -2 Query: 521 MVMTNGRQRDETDWSEIFIKAGFSDYKVVKKLGARGVFEVYP 396 M NG++R+E +W ++FI+AGF YK+ G + E+YP Sbjct: 311 MACLNGKERNEEEWKKLFIEAGFQHYKISPLTGFLSLIEIYP 352
>7OMT8_MEDSA (O24529) Isoflavone-7-O-methytransferase 8 (EC 2.1.1.150)| (Isoflavone-O-methytransferase 8) (7-IOMT-8) Length = 352 Score = 45.1 bits (105), Expect = 1e-04 Identities = 17/42 (40%), Positives = 27/42 (64%) Frame = -2 Query: 521 MVMTNGRQRDETDWSEIFIKAGFSDYKVVKKLGARGVFEVYP 396 M NG++R+E +W ++FI+AGF YK+ G + E+YP Sbjct: 311 MACLNGKERNEEEWKKLFIEAGFQHYKISPLTGFLSLIEIYP 352
>7OMT6_MEDSA (O22308) Isoflavone-7-O-methytransferase 6 (EC 2.1.1.150)| (Isoflavone-O-methytransferase 6) (7-IOMT-6) Length = 352 Score = 45.1 bits (105), Expect = 1e-04 Identities = 17/42 (40%), Positives = 27/42 (64%) Frame = -2 Query: 521 MVMTNGRQRDETDWSEIFIKAGFSDYKVVKKLGARGVFEVYP 396 M NG++R+E +W ++FI+AGF YK+ G + E+YP Sbjct: 311 MACLNGKERNEEEWKKLFIEAGFQHYKISPLTGFLSLIEIYP 352
>EOMT1_OCIBA (Q93WU2) Eugenol O-methyltransferase (EC 2.1.1.146) ((Iso)eugenol| O-methyltransferase EOMT1) (S-adenosysl-L-methionine:(Iso)eugenol O-methyltransferase EOMT1) Length = 357 Score = 41.6 bits (96), Expect = 0.001 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = -2 Query: 530 VAMMVMTNGRQRDETDWSEIFIKAGFSDYKVVKKLGARGVFEVYP 396 +AMM N ++R ++W ++ AGF YK+ G R + E YP Sbjct: 313 MAMMCYFNAKERTMSEWEKLIYDAGFKSYKLTPAFGVRSLIEAYP 357
>CVMT1_OCIBA (Q93WU3) Chavicol O-methyltransferase (EC 2.1.1.146) ((Iso)eugenol| O-methyltransferase CVOMT1) (S-adenosysl-L-methionine:(Iso)eugenol O-methyltransferase CVOMT1) Length = 356 Score = 40.8 bits (94), Expect = 0.002 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = -2 Query: 530 VAMMVMTNGRQRDETDWSEIFIKAGFSDYKVVKKLGARGVFEVYP 396 +AMM N ++R +W ++ AGF+ YK+ G R + E YP Sbjct: 312 MAMMSYFNAKERTMNEWEKLISAAGFTSYKLTPAFGVRSLIEAYP 356
>6OMT_COPJA (Q9LEL6) (RS)-norcoclaurine 6-O-methyltransferase (EC 2.1.1.128)| (S-adenosyl-L-methionine:norcoclaurine 6-O-methyltransferase) (6-OMT) Length = 347 Score = 38.1 bits (87), Expect = 0.015 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = -2 Query: 524 MMVMTNGRQRDETDWSEIFIKAGFSDYKVVKKLGARGVFEVYP 396 MM+ T G++R E +W ++ AG+ +K+ + + V E YP Sbjct: 304 MMLNTGGKERTEEEWKKLIHDAGYKGHKITQITAVQSVIEAYP 346
>4OMT_COPJA (Q9LEL5) 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase| (EC 2.1.1.116) (S-adenosyl-L-methionine:3'-hydroxy-N-methylcoclaurine 4'-O-methyltransferase) (4'-OMT) Length = 350 Score = 34.7 bits (78), Expect = 0.17 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = -2 Query: 530 VAMMVMTNGRQRDETDWSEIFIKAGFSDYKVVKKLGARGVFEVYP 396 + M+V T G++R + W +I AGFS K+ + V EV+P Sbjct: 306 IDMLVNTGGKERTKEVWEKIVKSAGFSGCKIRHIAAIQSVIEVFP 350
>NRFE_ECOLI (P32710) Cytochrome c-type biogenesis protein nrfE| Length = 552 Score = 30.8 bits (68), Expect = 2.4 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -2 Query: 212 KVRWGVMHNMGCYALLVTFQSVKLLFGVLKHSVCFSEYRV 93 ++RW M + C +L F + L FGVL + S++ V Sbjct: 12 RLRWPAMMRLTCIGILAQFALLLLAFGVLTYCFLISDFSV 51
>QUEA_CLOPE (Q8XJ15) S-adenosylmethionine:tRNA ribosyltransferase-isomerase (EC| 5.-.-.-) (Queuosine biosynthesis protein queA) Length = 341 Score = 29.3 bits (64), Expect = 7.1 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = -2 Query: 509 NGRQRDETDWSEIFIKAGFSDYKVVKKL 426 NGR R+++ W++IFI G+ +K+V L Sbjct: 267 NGRVREQSGWTDIFIYPGYK-FKIVDNL 293
>CTX_PSEAE (P14608) Cytotoxin precursor (Leucocidin)| Length = 286 Score = 28.9 bits (63), Expect = 9.2 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = -3 Query: 301 EYYNLWFASVDVLYGNCLTLPDMSGG*YCTR*DGVLCIIWGAMHSWLLSNL 149 +Y+ LWF V+ ++ C+ ++ Y + +GVL G HS + NL Sbjct: 199 DYHYLWFIPVEQVFWECVQHNIVNTSGYVVQGNGVLAQATGTFHSSVGLNL 249 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,192,015 Number of Sequences: 219361 Number of extensions: 1656795 Number of successful extensions: 3541 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 3478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3541 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4085413911 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)