ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart28g04 |
|---|---|
| Clone Library Name | barley_pub |
>FUCO2_ARATH (Q9FXE5) Alpha-L-fucosidase 2 precursor (EC 3.2.1.51)| (Alpha-L-fucoside fucohydrolase 2) (Alpha-1,2-fucosidase) (AtFXG1) Length = 372 Score = 30.8 bits (68), Expect = 0.83 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -1 Query: 375 PCRDRKAYVFWDAYHTSDAANRVIADRLWAGMT 277 PC + V WD H + AAN+ I D++ G++ Sbjct: 334 PCDEPDKAVVWDGVHFTQAANKFIFDKIAPGLS 366
>TM9S4_HUMAN (Q92544) Transmembrane 9 superfamily protein member 4| Length = 625 Score = 27.7 bits (60), Expect = 7.0 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -2 Query: 155 VYFGHCFSLNCGIWVKY 105 V FG CF LNC IW K+ Sbjct: 406 VVFGICFVLNCFIWGKH 422
>YAE3_SCHPO (Q09844) Hypothetical protein C23D3.03c in chromosome I| Length = 472 Score = 27.3 bits (59), Expect = 9.1 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = -1 Query: 189 LKPTLMLIDLACLLRTLLQFKLWDLGEVPQFIRCV 85 LKP L++ D +L LL F+ WDLG +F+ V Sbjct: 433 LKPKLLVDDSRLVLSALL-FENWDLGPEDEFMHFV 466
>TRUD_SHISS (Q3YYB7) tRNA pseudouridine synthase D (EC 5.4.99.-) (tRNA-uridine| isomerase D) (tRNA pseudouridylate synthase D) Length = 349 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 Query: 381 STPCRDRKAYVFWDAYHTSDAANRVIADRL 292 +TP RDR FW + S N+++A+RL Sbjct: 182 NTPVRDRNKRSFWLSAARSALFNQIVAERL 211
>TRUD_SHIFL (Q83QE3) tRNA pseudouridine synthase D (EC 5.4.99.-) (tRNA-uridine| isomerase D) (tRNA pseudouridylate synthase D) Length = 349 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 Query: 381 STPCRDRKAYVFWDAYHTSDAANRVIADRL 292 +TP RDR FW + S N+++A+RL Sbjct: 182 NTPVRDRNKRSFWLSAARSALFNQIVAERL 211
>TRUD_SHIDS (Q32CI5) tRNA pseudouridine synthase D (EC 5.4.99.-) (tRNA-uridine| isomerase D) (tRNA pseudouridylate synthase D) Length = 349 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 Query: 381 STPCRDRKAYVFWDAYHTSDAANRVIADRL 292 +TP RDR FW + S N+++A+RL Sbjct: 182 NTPVRDRNKRSFWLSAARSALFNQIVAERL 211
>TRUD_SHIBS (Q31XA7) tRNA pseudouridine synthase D (EC 5.4.99.-) (tRNA-uridine| isomerase D) (tRNA pseudouridylate synthase D) Length = 349 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 Query: 381 STPCRDRKAYVFWDAYHTSDAANRVIADRL 292 +TP RDR FW + S N+++A+RL Sbjct: 182 NTPVRDRNKRSFWLSAARSALFNQIVAERL 211
>TRUD_ECOLI (Q57261) tRNA pseudouridine synthase D (EC 5.4.99.-) (tRNA-uridine| isomerase D) (tRNA pseudouridylate synthase D) Length = 349 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 Query: 381 STPCRDRKAYVFWDAYHTSDAANRVIADRL 292 +TP RDR FW + S N+++A+RL Sbjct: 182 NTPVRDRNKRSFWLSAARSALFNQIVAERL 211
>TRUD_ECOL6 (Q8FEJ7) tRNA pseudouridine synthase D (EC 5.4.99.-) (tRNA-uridine| isomerase D) (tRNA pseudouridylate synthase D) Length = 349 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 Query: 381 STPCRDRKAYVFWDAYHTSDAANRVIADRL 292 +TP RDR FW + S N+++A+RL Sbjct: 182 NTPVRDRNKRSFWLSAARSALFNQIVAERL 211
>TRUD_ECO57 (Q8X7Y6) tRNA pseudouridine synthase D (EC 5.4.99.-) (tRNA-uridine| isomerase D) (tRNA pseudouridylate synthase D) Length = 349 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 Query: 381 STPCRDRKAYVFWDAYHTSDAANRVIADRL 292 +TP RDR FW + S N+++A+RL Sbjct: 182 NTPVRDRNKRSFWLSAARSALFNQIVAERL 211 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,451,063 Number of Sequences: 219361 Number of extensions: 648176 Number of successful extensions: 1343 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1328 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1343 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 1391514312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
