Clone Name | rbart28f04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | EBP2_YEAST (P36049) rRNA-processing protein EBP2 (EBNA1-binding ... | 32 | 0.67 | 2 | CT045_HUMAN (Q9Y3B1) Protein C20orf45 | 31 | 1.1 | 3 | CT045_MOUSE (Q9CYY7) Protein C20orf45 homolog | 30 | 3.3 | 4 | PRM2_RAT (P11248) Protamine-2 (Protamine-P2) (Sperm histone P2) | 28 | 7.4 | 5 | G13A_DICDI (P34115) Cell surface glycoprotein gp138A precursor | 28 | 9.7 |
---|
>EBP2_YEAST (P36049) rRNA-processing protein EBP2 (EBNA1-binding protein| homolog) Length = 427 Score = 32.0 bits (71), Expect = 0.67 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +3 Query: 78 ERIHIGWVPTTNTEHRSIKTRTMFGRHNQQRYHELEREFSWY 203 ER+ + W + EH+S+ + T H + Y + ERE ++Y Sbjct: 206 ERVQLPWKKHSFQEHQSVTSETNTDEHIKDIYDDTERELAFY 247
>CT045_HUMAN (Q9Y3B1) Protein C20orf45| Length = 194 Score = 31.2 bits (69), Expect = 1.1 Identities = 22/80 (27%), Positives = 34/80 (42%) Frame = +1 Query: 7 KPHEQQRGDGIYSQVCFHLTKLTRKEYTLDGFPQRTLSTEA*KHGRCSDDTINKDTMS*S 186 KPH Q + +Q K L+G T+S+ A K + I+K Sbjct: 113 KPHPQDPEKTVLTQEAIITVKGVSLSSYLEGLMASTISSNASKGREAMEWVIHKLNAEIE 172 Query: 187 ESSAGTKGIGRHPLAASSLA 246 E +A +G R P+AA++ A Sbjct: 173 ELTASARGTIRTPMAAAAFA 192
>CT045_MOUSE (Q9CYY7) Protein C20orf45 homolog| Length = 195 Score = 29.6 bits (65), Expect = 3.3 Identities = 22/80 (27%), Positives = 34/80 (42%) Frame = +1 Query: 1 TRKPHEQQRGDGIYSQVCFHLTKLTRKEYTLDGFPQRTLSTEA*KHGRCSDDTINKDTMS 180 T KPH Q + +Q K L+G T+S+ A K + I+K Sbjct: 111 TYKPHLQDPEKTVLTQEALITVKGVSLSSYLEGLMASTISSNASKGREAMEWVIHKLNAE 170 Query: 181 *SESSAGTKGIGRHPLAASS 240 E +A +G R P+AA++ Sbjct: 171 IEELAASARGSIRTPMAAAA 190
>PRM2_RAT (P11248) Protamine-2 (Protamine-P2) (Sperm histone P2)| Length = 104 Score = 28.5 bits (62), Expect = 7.4 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -1 Query: 422 DQGQGNRLQHQGQDRCRHTIRQHEAAHRPCRRNH 321 +QGQG L + + T R H HR C+R H Sbjct: 25 EQGQGQELSPERVEDYGRTERGHHHRHRRCKRLH 58
>G13A_DICDI (P34115) Cell surface glycoprotein gp138A precursor| Length = 730 Score = 28.1 bits (61), Expect = 9.7 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -2 Query: 406 TGYSIKGKIDVDTPFGNMKLPIDHVGG 326 TGYSI ++V+ GN++LP+ + G Sbjct: 168 TGYSIPTLVNVNPYLGNLQLPVTYYSG 194 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,798,613 Number of Sequences: 219361 Number of extensions: 1220890 Number of successful extensions: 2500 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2460 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2500 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)