Clone Name | rbart28d08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PAP3_ORYSA (Q7XBW5) Probable plastid-lipid associated protein 3,... | 29 | 4.9 | 2 | 2DMB_MOUSE (P35737) Class II histocompatibility antigen, M beta ... | 28 | 8.4 | 3 | RAD50_HALVO (P62133) DNA double-strand break repair rad50 ATPase | 28 | 8.4 |
---|
>PAP3_ORYSA (Q7XBW5) Probable plastid-lipid associated protein 3, chloroplast| precursor Length = 374 Score = 29.3 bits (64), Expect = 4.9 Identities = 17/46 (36%), Positives = 25/46 (54%) Frame = -1 Query: 289 DEDKEVAALERQEEVEACAAEIESGSDKVFRSILHTRVALLNIQTQ 152 +ED E ER+EE++ C + GSD FR+ R +L + TQ Sbjct: 138 EEDNEE---ERREELKRCLVDTVYGSDLGFRASSEVRGEVLELVTQ 180
>2DMB_MOUSE (P35737) Class II histocompatibility antigen, M beta 1 chain| precursor (H2-M beta 1 chain) Length = 261 Score = 28.5 bits (62), Expect = 8.4 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -2 Query: 135 IQNALPSLA*RSPFFWTIIVILSKPPSVHTNRST 34 +QN LP A + FW + ++PPSV ++T Sbjct: 90 LQNGLPDCASHTQPFWNALTHRTRPPSVRVAQTT 123
>RAD50_HALVO (P62133) DNA double-strand break repair rad50 ATPase| Length = 893 Score = 28.5 bits (62), Expect = 8.4 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -1 Query: 310 MRAKASSDEDKEVAALERQEEVEACAAEIESGSD 209 + AK S+DE K ER E++A A E+ES D Sbjct: 263 LTAKISADETKRDDLSERVRELDAAADELESDID 296 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,544,813 Number of Sequences: 219361 Number of extensions: 713455 Number of successful extensions: 2089 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2048 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2088 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)