| Clone Name | rbart28d01 |
|---|---|
| Clone Library Name | barley_pub |
>ATC9_SCHPO (O74431) Probable cation-transporting ATPase C1672.11c (EC 3.6.3.-)| Length = 1315 Score = 32.3 bits (72), Expect = 0.71 Identities = 32/113 (28%), Positives = 47/113 (41%), Gaps = 7/113 (6%) Frame = +1 Query: 46 AIKNFRHSTLHKSLHESVSGYSLQHQQYEIRLHADAAGLSAQE*EGSGESNDQQTLPRTA 225 ++ +F H TL S SVS +S+ + Q E L+ G E S D Q+L R Sbjct: 49 SVSSFHHQTLRPSSDASVSQFSMDYLQSEYNLNRYNDG------ESIAASRDYQSLLRDN 102 Query: 226 SASFWS-------CAWEDLHWHTKNCSVLRTRNLAKALL*ERRPWGLSRSGMC 363 + +S E+L+ H VLR ++ +A GLS G C Sbjct: 103 GSGVYSDEEEITEMMLEELNIH----PVLRRESVGEAA-------GLSEDGCC 144
>ACS1_CANGA (Q6FLU2) Acetyl-coenzyme A synthetase 1 (EC 6.2.1.1) (Acetate--CoA| ligase 1) (Acyl-activating enzyme 1) Length = 704 Score = 29.6 bits (65), Expect = 4.6 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +1 Query: 7 GKLHSCYFCLVFHAIKNFRHSTLHKSLHESVSGYSLQHQQ 126 G+L++CY C+ HA+K + + E GYS+ +++ Sbjct: 120 GQLNTCYNCVDRHALKTPNKTAIIYEADEPGEGYSMSYKE 159
>ENV_CAEVC (P31626) Env polyprotein (Coat polyprotein) [Contains: Leader| peptide; Surface protein; Transmembrane protein] Length = 966 Score = 29.3 bits (64), Expect = 6.0 Identities = 16/57 (28%), Positives = 27/57 (47%) Frame = +1 Query: 85 LHESVSGYSLQHQQYEIRLHADAAGLSAQE*EGSGESNDQQTLPRTASASFWSCAWE 255 ++ ++S + Q + AD AG + +G ES++ +T R WS AWE Sbjct: 835 IYRTLSTPTYQRVTVIMETRADVAGENQDFGDGLEESDNSETSERVTVQKAWSRAWE 891
>ENV_CAEVG (P31627) Env polyprotein precursor (Coat polyprotein) [Contains:| Leader peptide; Surface protein; Transmembrane protein] Length = 942 Score = 28.9 bits (63), Expect = 7.8 Identities = 21/79 (26%), Positives = 34/79 (43%) Frame = +1 Query: 85 LHESVSGYSLQHQQYEIRLHADAAGLSAQE*EGSGESNDQQTLPRTASASFWSCAWEDLH 264 ++ ++S + Q + AD AG + +G ES+D +T + WS AWE Sbjct: 833 IYRTLSTPTYQRVTVIMEKRADVAGENQDFGDGLEESDDSKTDQKVTVQKAWSRAWE--L 890 Query: 265 WHTKNCSVLRTRNLAKALL 321 W R+L K L+ Sbjct: 891 WQNSPWKEPWKRSLLKLLI 909
>TR11B_RAT (O08727) Tumor necrosis factor receptor superfamily member 11B| precursor (Osteoprotegerin) Length = 401 Score = 28.9 bits (63), Expect = 7.8 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 284 VYFAPET*PKLSCRSGVPGDYLDQACVSKRR 376 +++ PET +L C PG YL Q C +R+ Sbjct: 29 LHYDPETGRQLLCDKCAPGTYLKQHCTVRRK 59
>TR11B_MOUSE (O08712) Tumor necrosis factor receptor superfamily member 11B| precursor (Osteoprotegerin) (Osteoclastogenesis inhibitory factor) Length = 401 Score = 28.9 bits (63), Expect = 7.8 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 284 VYFAPET*PKLSCRSGVPGDYLDQACVSKRR 376 +++ PET +L C PG YL Q C +R+ Sbjct: 29 LHYDPETGHQLLCDKCAPGTYLKQHCTVRRK 59 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,461,896 Number of Sequences: 219361 Number of extensions: 1543914 Number of successful extensions: 3638 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3549 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3638 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)