| Clone Name | rbart28c10 |
|---|---|
| Clone Library Name | barley_pub |
>R13AD_ARATH (Q9FKC0) 60S ribosomal protein L13a-4| Length = 206 Score = 58.2 bits (139), Expect = 1e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 498 YDRRKQLAKLRVKAEKAAEEKLGTQLEILAPIKY 397 Y+R+KQL KLRVKAEK AEEKLG QL+ILAP+KY Sbjct: 173 YERKKQLNKLRVKAEKVAEEKLGAQLDILAPVKY 206
>R13AA_ARATH (Q9SFU1) 60S ribosomal protein L13a-1| Length = 206 Score = 57.8 bits (138), Expect = 2e-08 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = -1 Query: 498 YDRRKQLAKLRVKAEKAAEEKLGTQLEILAPIKY 397 Y+R+KQL+KLR KAEK AEEKLG+QL++LAP+KY Sbjct: 173 YERKKQLSKLRAKAEKVAEEKLGSQLDVLAPVKY 206
>RL13A_LUPLU (O49885) 60S ribosomal protein L13a| Length = 205 Score = 55.8 bits (133), Expect = 6e-08 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = -1 Query: 498 YDRRKQLAKLRVKAEKAAEEKLGTQLEILAPIKY 397 Y+R+KQL KLRVKAE+ A+EKLG+QL+ILAP+KY Sbjct: 172 YERKKQLNKLRVKAEQVAQEKLGSQLDILAPVKY 205
>R13AC_ARATH (Q9SVR0) 60S ribosomal protein L13a-3| Length = 206 Score = 55.5 bits (132), Expect = 8e-08 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -1 Query: 498 YDRRKQLAKLRVKAEKAAEEKLGTQLEILAPIKY 397 Y+R+KQL KLR KAEK AEE+LG+QL++LAP+KY Sbjct: 173 YERKKQLNKLRTKAEKVAEERLGSQLDVLAPVKY 206
>R13AB_ARATH (Q9LRX8) 60S ribosomal protein L13a-2| Length = 206 Score = 54.7 bits (130), Expect = 1e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 498 YDRRKQLAKLRVKAEKAAEEKLGTQLEILAPIKY 397 Y+R+KQL KLR KAEK AEEKLG+QL++LA IKY Sbjct: 173 YERKKQLTKLRAKAEKVAEEKLGSQLDVLASIKY 206
>RL13A_PICMA (O65055) 60S ribosomal protein L13a| Length = 206 Score = 43.9 bits (102), Expect = 2e-04 Identities = 20/34 (58%), Positives = 28/34 (82%) Frame = -1 Query: 498 YDRRKQLAKLRVKAEKAAEEKLGTQLEILAPIKY 397 Y+RRKQLAKLR KA + AE++L ++E+LA +KY Sbjct: 173 YERRKQLAKLRSKAVELAEKQLAPEMELLASLKY 206
>RL13A_BOVIN (Q3SZ90) 60S ribosomal protein L13a| Length = 202 Score = 31.2 bits (69), Expect = 1.6 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = -1 Query: 498 YDRRKQLAKLRVKAEKAAEEKLGTQLEIL 412 Y ++KQL +LR +AEK E+K+G E+L Sbjct: 167 YRKKKQLMRLRKQAEKNIEKKIGKFTEVL 195
>RL13A_PONPY (Q5RA38) 60S ribosomal protein L13a| Length = 202 Score = 30.0 bits (66), Expect = 3.6 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -1 Query: 498 YDRRKQLAKLRVKAEKAAEEKLGTQLEIL 412 Y ++KQL +LR +AEK E+K+ E+L Sbjct: 167 YRKKKQLVRLRKQAEKNVEKKIDKYTEVL 195
>RL13A_HUMAN (P40429) 60S ribosomal protein L13a (23 kDa highly basic protein)| Length = 202 Score = 29.6 bits (65), Expect = 4.7 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -1 Query: 498 YDRRKQLAKLRVKAEKAAEEKLGTQLEIL 412 Y ++KQL +LR +AEK E+K+ E+L Sbjct: 167 YRKKKQLMRLRKQAEKNVEKKIDKYTEVL 195
>T2R60_PONPY (Q645U7) Taste receptor type 2 member 60 (T2R60) (T2R56)| Length = 318 Score = 29.3 bits (64), Expect = 6.1 Identities = 19/60 (31%), Positives = 26/60 (43%) Frame = -3 Query: 256 LKFSTWSTVSFIKCVHLKILVNVYQVIIWCCSRFSSLQPWQPLVMACCGCFSDFLSYIKN 77 L FSTW +V + CV KI + V +W + S PW F+ L +I N Sbjct: 108 LWFSTWLSVFY--CV--KIATFTHPVFLWLKHKLSEWVPWMLFSSVGLSSFTTILFFIGN 163
>T2R60_MACMU (Q645S2) Taste receptor type 2 member 60 (T2R60) (T2R56)| Length = 318 Score = 28.9 bits (63), Expect = 7.9 Identities = 19/63 (30%), Positives = 28/63 (44%) Frame = -3 Query: 256 LKFSTWSTVSFIKCVHLKILVNVYQVIIWCCSRFSSLQPWQPLVMACCGCFSDFLSYIKN 77 L FS+W +V + CV KI + V +W + S PW F+ L +I N Sbjct: 108 LWFSSWLSVFY--CV--KIATFTHPVFLWLKHKLSEWVPWMFFSSVGLSSFTTILFFIGN 163 Query: 76 LSV 68 S+ Sbjct: 164 HSI 166
>NPT2C_MOUSE (Q80SU6) Sodium-dependent phosphate transport protein 2C| (Sodium/phosphate cotransporter 2C) (Na(+)/Pi cotransporter 2C) (Sodium-phosphate transport protein 2C) (Na(+)-dependent phosphate cotransporter 2C) (NaPi-2c) (Solute carrier family 34 Length = 601 Score = 28.9 bits (63), Expect = 7.9 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -3 Query: 172 WCCSRFSSLQPWQPLVMACCGC 107 W SL+PW LV ACC C Sbjct: 553 WLPLWLHSLEPWDRLVTACCPC 574
>CO9A2_CHICK (P12108) Collagen alpha-2(IX) chain precursor| Length = 677 Score = 28.9 bits (63), Expect = 7.9 Identities = 14/28 (50%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = -3 Query: 484 AAGEAPRQGREGSRGEVGNSA--GDPGP 407 A GE +QG++G +G+VG S G PGP Sbjct: 198 ALGEPGQQGKQGPKGDVGVSGEQGVPGP 225 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,976,792 Number of Sequences: 219361 Number of extensions: 1157041 Number of successful extensions: 2853 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2749 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2851 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3523384522 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)