ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart28c02 |
|---|---|
| Clone Library Name | barley_pub |
>Y5621_ARATH (O81488) PHD finger protein At5g26210| Length = 255 Score = 98.6 bits (244), Expect = 9e-21 Identities = 45/89 (50%), Positives = 52/89 (58%), Gaps = 1/89 (1%) Frame = -1 Query: 517 AEPRAKAKVPAPKXXXXXXXXXXXXXXXEHDN-TLCGTCGTNDGKDEFWICCDNCEKWYH 341 +E RAK P PK + T CG CG + DEFWICCD CE W+H Sbjct: 167 SESRAKFSKPEPKDDEEEEEEGVEEEDEDEQGETQCGACGESYAADEFWICCDLCEMWFH 226 Query: 340 GKCVKITPARAEHIKHYRCPECTNGGSNS 254 GKCVKITPARAEHIK Y+CP C+N + S Sbjct: 227 GKCVKITPARAEHIKQYKCPSCSNKRARS 255
>DIDO1_HUMAN (Q9BTC0) Death-inducer obliterator 1 (DIO-1) (Death-associated| transcription factor 1) (DATF-1) (hDido1) Length = 2240 Score = 52.0 bits (123), Expect = 1e-06 Identities = 25/65 (38%), Positives = 34/65 (52%), Gaps = 8/65 (12%) Frame = -1 Query: 385 DEFWICCDNCEKWYHGKCVKITPARAEHIKH----YRCPECT----NGGSNSNKRVKT*A 230 + F ICCD CE+W+HG CV I+ AR ++ Y CP CT ++S + A Sbjct: 279 NRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILQVQDETHSETADQQEA 338 Query: 229 GWAPG 215 W PG Sbjct: 339 KWRPG 343
>ATX3_ARATH (Q9M364) Histone-lysine N-methyltransferase ATX3 (EC 2.1.1.43)| (Trithorax-homolog protein 3) (TRX-homolog protein 3) (Protein SET DOMAIN GROUP 14) Length = 902 Score = 52.0 bits (123), Expect = 1e-06 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 4/54 (7%) Frame = -1 Query: 424 NTLCGTCGT--NDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKH--YRCPEC 275 N CG C + D W+CCD C+ W H +C IT R + ++H Y CP+C Sbjct: 348 NQYCGICKRIWHPSDDGDWVCCDGCDVWVHAECDNITNERFKELEHNNYYCPDC 401
>DIDO1_MOUSE (Q8C9B9) Death-inducer obliterator 1 (DIO-1) (Death-associated| transcription factor 1) (DATF-1) (Fragments) Length = 1956 Score = 50.4 bits (119), Expect = 3e-06 Identities = 20/42 (47%), Positives = 26/42 (61%), Gaps = 4/42 (9%) Frame = -1 Query: 385 DEFWICCDNCEKWYHGKCVKITPARAEHIKH----YRCPECT 272 + F ICCD CE+W+HG CV I+ AR ++ Y CP CT Sbjct: 276 NRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCT 317
>CXCC1_MOUSE (Q9CWW7) CpG-binding protein (PHD finger and CXXC domain-containing| protein 1) (CXXC finger protein 1) Length = 660 Score = 48.5 bits (114), Expect = 1e-05 Identities = 17/35 (48%), Positives = 24/35 (68%) Frame = -1 Query: 379 FWICCDNCEKWYHGKCVKITPARAEHIKHYRCPEC 275 F I CDNC +W+HG C++IT A+ I+ + C EC Sbjct: 39 FMIGCDNCNEWFHGDCIRITEKMAKAIREWYCREC 73
>CXCC1_HUMAN (Q9P0U4) CpG-binding protein (PHD finger and CXXC domain-containing| protein 1) (CXXC finger protein 1) Length = 656 Score = 48.5 bits (114), Expect = 1e-05 Identities = 17/35 (48%), Positives = 24/35 (68%) Frame = -1 Query: 379 FWICCDNCEKWYHGKCVKITPARAEHIKHYRCPEC 275 F I CDNC +W+HG C++IT A+ I+ + C EC Sbjct: 39 FMIGCDNCNEWFHGDCIRITEKMAKAIREWYCREC 73
>SPP1_SCHPO (O74508) Set1 complex component spp1 (Set1C component spp1)| (COMPASS component spp1) (Complex proteins associated with set1 protein spp1) Length = 424 Score = 45.8 bits (107), Expect = 7e-05 Identities = 25/85 (29%), Positives = 33/85 (38%), Gaps = 1/85 (1%) Frame = -1 Query: 514 EPRAKAKVPAPKXXXXXXXXXXXXXXXEHDNTLCGTCGTNDGKDEFWIC-CDNCEKWYHG 338 +P A P+ +H L C D D W+ CD CE W+HG Sbjct: 87 KPPVSAHRRGPRKHRGNANSQLNLSTADHQRPLYCICQKPD--DGSWMLGCDGCEDWFHG 144 Query: 337 KCVKITPARAEHIKHYRCPECTNGG 263 CV I + + Y CP+CT G Sbjct: 145 TCVNIPESYNDLTVQYFCPKCTEEG 169
>PHF2_MOUSE (Q9WTU0) PHD finger protein 2 (GRC5)| Length = 1096 Score = 45.4 bits (106), Expect = 9e-05 Identities = 20/47 (42%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = -1 Query: 379 FWICCDNCEKWYHGKCVKITPARAEHIKHYRCPEC--TNGGSNSNKR 245 F I CD C+ W+HG CV + A I Y CP C T+G S K+ Sbjct: 19 FMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNCEKTHGKSTLKKK 65
>PHF2_HUMAN (O75151) PHD finger protein 2 (GRC5)| Length = 1101 Score = 45.4 bits (106), Expect = 9e-05 Identities = 20/47 (42%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = -1 Query: 379 FWICCDNCEKWYHGKCVKITPARAEHIKHYRCPEC--TNGGSNSNKR 245 F I CD C+ W+HG CV + A I Y CP C T+G S K+ Sbjct: 19 FMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNCEKTHGKSTLKKK 65
>K1718_MOUSE (Q3UWM4) Protein KIAA1718| Length = 940 Score = 44.7 bits (104), Expect = 2e-04 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = -1 Query: 385 DEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPECT--NGGSNSNKR 245 + F I CD C+ W+HG CV + A I Y CP+C +G S KR Sbjct: 49 NRFMIECDVCKDWFHGSCVGVEEHHAVDIDLYHCPDCAALHGSSLMKKR 97
>PHF8_MOUSE (Q80TJ7) PHD finger protein 8| Length = 1023 Score = 44.7 bits (104), Expect = 2e-04 Identities = 20/47 (42%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = -1 Query: 379 FWICCDNCEKWYHGKCVKITPARAEHIKHYRCPEC--TNGGSNSNKR 245 F I CD C+ W+HG CV + +A I Y CP C +G S KR Sbjct: 19 FMIECDMCQDWFHGSCVGVEEEKAADIDLYHCPNCEVLHGPSIMKKR 65
>PHF8_HUMAN (Q9UPP1) PHD finger protein 8| Length = 1060 Score = 44.7 bits (104), Expect = 2e-04 Identities = 20/47 (42%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = -1 Query: 379 FWICCDNCEKWYHGKCVKITPARAEHIKHYRCPEC--TNGGSNSNKR 245 F I CD C+ W+HG CV + +A I Y CP C +G S KR Sbjct: 55 FMIECDMCQDWFHGSCVGVEEEKAADIDLYHCPNCEVLHGPSIMKKR 101
>JHD1_CANAL (Q5A847) JmjC domain-containing histone demethylation protein 1 (EC| 1.14.11.-) Length = 478 Score = 43.9 bits (102), Expect = 3e-04 Identities = 20/63 (31%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Frame = -1 Query: 430 HDNTLCGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPECT-NGGSNS 254 H NT+ + WI C C+ WYH C+ + + I Y CPEC G ++ Sbjct: 14 HSNTIKKEDEDEEDNKTSWIQCSKCKVWYHVHCLDLPTDEIDQIVIYHCPECVPKYGEST 73 Query: 253 NKR 245 KR Sbjct: 74 YKR 76
>K1718_HUMAN (Q6ZMT4) Protein KIAA1718| Length = 941 Score = 43.9 bits (102), Expect = 3e-04 Identities = 20/49 (40%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -1 Query: 385 DEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPECT--NGGSNSNKR 245 + F I CD C+ W+HG CV + A I Y CP C +G S KR Sbjct: 49 NRFMIECDICKDWFHGSCVGVEEHHAVDIDLYHCPNCAVLHGSSLMKKR 97
>JHD1_YARLI (Q6C423) JmjC domain-containing histone demethylation protein 1 (EC| 1.14.11.-) Length = 510 Score = 42.7 bits (99), Expect = 6e-04 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = -1 Query: 415 CGTCGTNDGKD-EFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPECT 272 C C ++ KD + W CD C++W H CV IT + Y CP CT Sbjct: 5 CDFCTSSSTKDKQQWTQCDGCDRWVHDVCVSITDPVS--YAKYHCPTCT 51
>JHD1_YEAST (P40034) JmjC domain-containing histone demethylation protein 1 (EC| 1.14.11.-) (ScJHDM1) Length = 492 Score = 42.4 bits (98), Expect = 8e-04 Identities = 22/70 (31%), Positives = 28/70 (40%), Gaps = 16/70 (22%) Frame = -1 Query: 427 DNTLCGTCGTNDGKDEF-WICCDNCEKWYHGKCVKIT---------------PARAEHIK 296 D +C C D W+ CD+C +W H KCV + P A+ IK Sbjct: 3 DPNICQHCQLKDNPGALIWVKCDSCPQWVHVKCVPLKRIHYSNLTSSEVLSYPNSAKQIK 62 Query: 295 HYRCPECTNG 266 YRCP G Sbjct: 63 SYRCPNHKEG 72
>JHD1_DEBHA (Q6BXJ4) JmjC domain-containing histone demethylation protein 1 (EC| 1.14.11.-) Length = 514 Score = 41.6 bits (96), Expect = 0.001 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = -1 Query: 376 WICCDNCEKWYHGKCVKITPARAEHIKHYRCPEC--TNGGSNSNKRVK 239 W+ CD C +W+H C+KI ++ Y C C ++G S +++K Sbjct: 26 WLQCDICNQWFHASCLKIPKIEVNNLHSYHCEGCSKSHGPSIPKRKLK 73
>ATXR5_ARATH (Q8VZJ1) Histone-lysine N-methyltransferase ATXR5 (EC 2.1.1.43)| (Trithorax-related protein 5) (TRX-related protein 5) (Protein SET DOMAIN GROUP 15) Length = 352 Score = 40.4 bits (93), Expect = 0.003 Identities = 17/54 (31%), Positives = 30/54 (55%) Frame = -1 Query: 430 HDNTLCGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPECTN 269 + N C CG+ +G DE + CD C++ +H KC++ R I + C +C++ Sbjct: 62 YSNVTCEKCGSGEGDDEL-LLCDKCDRGFHMKCLRPIVVRVP-IGTWLCVDCSD 113
>PHF3_HUMAN (Q92576) PHD finger protein 3| Length = 2039 Score = 40.0 bits (92), Expect = 0.004 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 4/51 (7%) Frame = -1 Query: 415 CGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHI----KHYRCPEC 275 CG C G + F + C C+ W+HG CV ++ ++A+ + K Y C +C Sbjct: 720 CGFCKKPHG-NRFMVGCGRCDDWFHGDCVGLSLSQAQQMGEEDKEYVCVKC 769
>CTI6_YEAST (Q08923) Transcriptional regulatory protein CTI6| (CYC8-TUP1-interacting protein 6) Length = 506 Score = 38.9 bits (89), Expect = 0.008 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = -1 Query: 406 CGTNDGKDE--FWICCDNCEKWYHGKCVKITPARAEHIKHYRCPEC 275 CG D D+ F+I C+ C W HG CV IT A Y C +C Sbjct: 77 CGELDTPDDSGFFIQCEQCSSWQHGYCVSITQDNAP--DKYWCEQC 120
>Y1342_ARATH (Q9C810) PHD finger protein At1g33420| Length = 697 Score = 38.9 bits (89), Expect = 0.008 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = -1 Query: 406 CGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKH--YRCPECTNGGSNSNKR 245 CGT D E + CD C W+H +C+ I A A K +RC E + +K+ Sbjct: 608 CGTKDDDGERMLACDGCGVWHHTRCIGINNADALPSKFLCFRCIELYSKKPKQSKK 663
>SPP1_YEAST (Q03012) COMPASS component SPP1 (Complex proteins associated with| SET1 protein SPP1) (Set1C component SPP1) (Suppressor of PRP protein 1) Length = 353 Score = 37.7 bits (86), Expect = 0.019 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -1 Query: 382 EFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPECTNGGSNSNK 248 E + CD C+ W+H C+ I + + + CP C G + NK Sbjct: 34 ELMVGCDGCDDWFHFTCLHIPEQFKDLVFSFYCPYCQAGITGKNK 78
>LID2_SCHPO (Q9HDV4) Lid2 complex component lid2 (Lid2C component lid2)| Length = 1513 Score = 37.7 bits (86), Expect = 0.019 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -1 Query: 367 CDNCEKWYHGKCVKITPARAEHIKHYRCPEC 275 C+ C +WYH KC+K++ + + + CP C Sbjct: 1112 CEICHEWYHAKCLKMSKKKLRQDEKFTCPIC 1142 Score = 33.1 bits (74), Expect = 0.46 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = -1 Query: 424 NTLCGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPEC 275 N+ C CG + +I C CE+ +H CV + A+ + + CP C Sbjct: 1352 NSSC-LCGEEFSPRDSFIDCTICERRFHYDCVGLNNEIADSVSKFTCPIC 1400
>SET4_YEAST (P42948) SET domain protein 4| Length = 560 Score = 37.4 bits (85), Expect = 0.025 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = -1 Query: 406 CGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKH-YRCPECTNGGSNSNKRVK 239 CG++D KDE +I C+ C+ W H C +++ IK + C C + +VK Sbjct: 165 CGSSDSKDELFIQCNKCKTWQHKLCYAF--KKSDPIKRDFVCKRCDSDTKVQVNQVK 219
>TCF19_PIG (Q9TSV4) Transcription factor 19 (Transcription factor SC1)| Length = 346 Score = 37.0 bits (84), Expect = 0.032 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -1 Query: 376 WICCDNCEKWYHGKCVKITPARAEHIKHYRCPECTNG 266 W+ CD C+ W+H CV + A+ +RCP C G Sbjct: 308 WVQCDGCDTWFHVACVGCSIQAAKE-ADFRCPGCRVG 343
>TCF19_PANTR (Q7YR48) Transcription factor 19 (Transcription factor SC1)| Length = 345 Score = 37.0 bits (84), Expect = 0.032 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -1 Query: 376 WICCDNCEKWYHGKCVKITPARAEHIKHYRCPECTNG 266 W+ CD C+ W+H CV + +A +RCP C G Sbjct: 307 WVQCDGCDVWFHVACVGCS-IQAAREADFRCPGCRAG 342
>TCF19_MACMU (Q5TM48) Transcription factor 19| Length = 345 Score = 37.0 bits (84), Expect = 0.032 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -1 Query: 376 WICCDNCEKWYHGKCVKITPARAEHIKHYRCPECTNG 266 W+ CD C+ W+H CV + +A +RCP C G Sbjct: 307 WVQCDGCDVWFHVACVGCS-IQAAREADFRCPGCRAG 342
>TCF19_HUMAN (Q9Y242) Transcription factor 19 (Transcription factor SC1)| Length = 345 Score = 37.0 bits (84), Expect = 0.032 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -1 Query: 376 WICCDNCEKWYHGKCVKITPARAEHIKHYRCPECTNG 266 W+ CD C+ W+H CV + +A +RCP C G Sbjct: 307 WVQCDGCDVWFHVACVGCS-IQAAREADFRCPGCRAG 342
>MSC1_SCHPO (Q9UT79) Multicopy suppressor of chk1 protein 1| Length = 1588 Score = 36.6 bits (83), Expect = 0.042 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -1 Query: 367 CDNCEKWYHGKCVKITPARAEHIKHYRCPEC 275 C NC +W+H +CV ++ + +Y CP+C Sbjct: 1472 CHNCLEWFHYECVGLSSDIVSTLSNYACPDC 1502 Score = 36.2 bits (82), Expect = 0.055 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -1 Query: 367 CDNCEKWYHGKCVKITPARAEHIKHYRCPEC 275 C+ C +WYH KC+K++ + + + CP C Sbjct: 1187 CELCHEWYHAKCMKMSKKKLRADEKFICPIC 1217
>JHD1_CRYNE (Q55NZ6) JmjC domain-containing histone demethylation protein 1 (EC| 1.14.11.-) Length = 879 Score = 36.6 bits (83), Expect = 0.042 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 400 TNDGKDEFWICCDNCEKWYHGKCV 329 TN+ D W+ C+ C++WYH C+ Sbjct: 46 TNEDIDFIWVACNKCDEWYHSACL 69
>MLL3_HUMAN (Q8NEZ4) Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog| (Histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3) (EC 2.1.1.43) (Homologous to ALR protein) Length = 4911 Score = 36.6 bits (83), Expect = 0.042 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = -1 Query: 418 LCGTCGT-NDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPECT 272 +C CG+ G + + C C + YH CV I + K +RC ECT Sbjct: 959 MCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLECT 1008 Score = 32.0 bits (71), Expect = 1.0 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 5/59 (8%) Frame = -1 Query: 418 LCGTCGTNDGKDEFWICCDNCEKWYHGKC----VKITPARAEHIKHYR-CPECTNGGSN 257 +C C G+D + CD C+K YH C +K P K+ R C EC S+ Sbjct: 390 VCQNC-KQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCRICIECGTRSSS 447 Score = 32.0 bits (71), Expect = 1.0 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Frame = -1 Query: 415 CGTCGT-NDGKDEFWICCDNCEKWYHGKC--VKITPARAEHIKHYRCPEC 275 C C + D D+F+ C C + YHG C + +TP + ++CPEC Sbjct: 344 CAVCDSPGDLLDQFF--CTTCGQHYHGMCLDIAVTPLKR---AGWQCPEC 388
>MLL3_MOUSE (Q8BRH4) Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog| (Histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3) (EC 2.1.1.43) Length = 4903 Score = 36.6 bits (83), Expect = 0.042 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = -1 Query: 418 LCGTCGT-NDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPECT 272 +C CG+ G + + C C + YH CV I + K +RC ECT Sbjct: 952 MCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLECT 1001 Score = 32.0 bits (71), Expect = 1.0 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Frame = -1 Query: 415 CGTCGT-NDGKDEFWICCDNCEKWYHGKC--VKITPARAEHIKHYRCPEC 275 C C + D D+F+ C C + YHG C + +TP + ++CPEC Sbjct: 343 CAVCDSPGDLLDQFF--CTTCGQHYHGMCLDIAVTPLKR---AGWQCPEC 387 Score = 31.6 bits (70), Expect = 1.3 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 5/53 (9%) Frame = -1 Query: 418 LCGTCGTNDGKDEFWICCDNCEKWYHGKC----VKITPARAEHIKHYR-CPEC 275 +C C G+D + CD C+K YH C +K P K+ R C EC Sbjct: 389 VCQNC-KQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCRICIEC 440
>PKCB1_HUMAN (Q9ULU4) Protein kinase C-binding protein 1 (Rack7) (Cutaneous| T-cell lymphoma associated antigen se14-3) (CTCL tumor antigen se14-3) (Zinc finger MYND domain containing protein 8) Length = 1186 Score = 36.2 bits (82), Expect = 0.055 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 10/50 (20%) Frame = -1 Query: 394 DGKDEFW----------ICCDNCEKWYHGKCVKITPARAEHIKHYRCPEC 275 DG+++F+ +CC+ C + YH KC+++T +E + CPEC Sbjct: 84 DGRNDFYCWVCHREGQVLCCELCPRVYHAKCLRLT---SEPEGDWFCPEC 130
>PKL_ARATH (Q9S775) CHD3-type chromatin remodeling factor PICKLE (EC 3.6.1.-)| (Protein GYMNOS) Length = 1384 Score = 36.2 bits (82), Expect = 0.055 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = -1 Query: 415 CGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPECTN 269 C CG + + C+ C +H KC+ + P + ++++RCPEC + Sbjct: 52 CQACGESTNL----VSCNTCTYAFHAKCL-VPPLKDASVENWRCPECVS 95
>JHD1_EMENI (Q5AW75) JmjC domain-containing histone demethylation protein 1 (EC| 1.14.11.-) Length = 1407 Score = 36.2 bits (82), Expect = 0.055 Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 7/54 (12%) Frame = -1 Query: 415 CGTCGT------NDGKDEFWICCDNCEKWYHGKCVKITPAR-AEHIKHYRCPEC 275 C TC N+ +D WI CD C++W+H C R + + C C Sbjct: 326 CATCNLVRIPVDNEDQDVTWISCDGCKRWFHIVCAGFKNDRETRTVDKFICKTC 379
>ATX5_ARATH (Q8GZ42) Histone-lysine N-methyltransferase ATX5 (EC 2.1.1.43)| (Trithorax-homolog protein 5) (TRX-homolog protein 5) (Protein SET DOMAIN GROUP 29) Length = 1043 Score = 36.2 bits (82), Expect = 0.055 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 4/52 (7%) Frame = -1 Query: 418 LCGTCGT--NDGKDEFWICCDNCEKWYHGKCVKITPARAEHI--KHYRCPEC 275 +CG C N + W+ CD C+ W H C +I+ + + Y CP C Sbjct: 415 VCGICKRIWNHLDSQSWVRCDGCKVWIHSACDQISHKHFKDLGETDYYCPTC 466
>TOP1_HELPY (P55991) DNA topoisomerase 1 (EC 5.99.1.2) (DNA topoisomerase I)| (Omega-protein) (Relaxing enzyme) (Untwisting enzyme) (Swivelase) Length = 736 Score = 35.8 bits (81), Expect = 0.071 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 4/67 (5%) Frame = -1 Query: 427 DNTLCGTCG----TNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPECTNGGS 260 D LC CG ++ ++ C+N + + K +K TP E I+ +CPEC GG Sbjct: 612 DQELCEKCGGEMVQKFSRNGAFLACNNYPECKNTKSLKNTPNAKETIEGVKCPEC--GGD 669 Query: 259 NSNKRVK 239 + KR K Sbjct: 670 IALKRSK 676
>JAD1A_HUMAN (P29375) Jumonji/ARID domain-containing protein 1A| (Retinoblastoma-binding protein 2) (RBBP-2) Length = 1722 Score = 35.8 bits (81), Expect = 0.071 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = -1 Query: 376 WICCDN-CEKWYHGKCVKITPARAEHIKHYRCPEC 275 W+ CD C++W+H CV ++P AE+ + Y C C Sbjct: 1657 WVQCDGGCDEWFHRVCVGVSPEMAEN-EDYICINC 1690 Score = 33.9 bits (76), Expect = 0.27 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = -1 Query: 427 DNTLCGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPEC 275 D +C CG + +D+ + CD C+ YH C+ I P +RCP+C Sbjct: 292 DLYVCMFCGRGNNEDKL-LLCDGCDDSYHTFCL-IPPLPDVPKGDWRCPKC 340
>HRX_HUMAN (Q03164) Zinc finger protein HRX (ALL-1) (Trithorax-like protein)| Length = 3969 Score = 35.4 bits (80), Expect = 0.093 Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 6/55 (10%) Frame = -1 Query: 418 LCGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKH------YRCPECT 272 LC C +D + + C C++W H KC ++ E + + Y C CT Sbjct: 1571 LCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCT 1625
>MLL2_HUMAN (O14686) Myeloid/lymphoid or mixed-lineage leukemia protein 2| (ALL1-related protein) Length = 5262 Score = 35.0 bits (79), Expect = 0.12 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = -1 Query: 418 LCGTCGT-NDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPEC 275 +C CG+ G + + C C + YH CV + +K +RC EC Sbjct: 1104 MCVVCGSFGRGAEGHLLACSQCSQCYHPYCVNSKITKVMLLKGWRCVEC 1152 Score = 30.4 bits (67), Expect = 3.0 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = -1 Query: 418 LCGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKH-YRCPEC 275 +C C G D + C+ C+K YH C+K P E H ++C C Sbjct: 275 VCQAC-RKPGNDSKMLVCETCDKGYHTFCLK--PPMEELPAHSWKCKAC 320 Score = 29.6 bits (65), Expect = 5.1 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = -1 Query: 415 CGTC-GTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPEC 275 C C G + D F+ C +C YHG C+ T A ++CPEC Sbjct: 229 CAVCEGPGELCDLFF--CTSCGHHYHGACLD-TALTARKRAGWQCPEC 273
>REQU_MOUSE (Q61103) Zinc-finger protein ubi-d4 (Requiem) (Apoptosis response| zinc finger protein) (D4, zinc and double PHD fingers family 2) Length = 391 Score = 35.0 bits (79), Expect = 0.12 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = -1 Query: 415 CGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAE 305 C CGT++ D+ + CD+C++ YH C +TP+ +E Sbjct: 330 CNLCGTSENDDQL-LFCDDCDRGYHMYC--LTPSMSE 363
>REQU_HUMAN (Q92785) Zinc-finger protein ubi-d4 (Requiem) (Apoptosis response| zinc finger protein) (D4, zinc and double PHD fingers family 2) Length = 391 Score = 35.0 bits (79), Expect = 0.12 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = -1 Query: 415 CGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAE 305 C CGT++ D+ + CD+C++ YH C +TP+ +E Sbjct: 330 CNICGTSENDDQL-LFCDDCDRGYHMYC--LTPSMSE 363
>HOX1A_MAIZE (P46605) Homeobox protein HOX1A| Length = 719 Score = 35.0 bits (79), Expect = 0.12 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 6/57 (10%) Frame = -1 Query: 427 DNTLCGTCGTNDGK--DEFWICCDNCEKWYHGKCVKITPARAEHI----KHYRCPEC 275 ++ C TCG+ND ++ +C C++ +H C+ P R E I + + CP C Sbjct: 208 EDIFCSTCGSNDATLGNDIILCDGACDRGFHQNCLN-PPLRTEDIPMGDEGWLCPAC 263
>REQU_CHICK (P58268) Zinc-finger protein ubi-d4 (Requiem) (Apoptosis response| zinc finger protein) Length = 405 Score = 34.3 bits (77), Expect = 0.21 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = -1 Query: 415 CGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAE 305 C CGT++ D+ + CD+C++ YH C +TP +E Sbjct: 344 CNICGTSENDDQL-LFCDDCDRGYHMYC--LTPPMSE 377
>TOP1_HELPJ (Q9ZMV7) DNA topoisomerase 1 (EC 5.99.1.2) (DNA topoisomerase I)| (Omega-protein) (Relaxing enzyme) (Untwisting enzyme) (Swivelase) Length = 736 Score = 33.9 bits (76), Expect = 0.27 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 4/64 (6%) Frame = -1 Query: 418 LCGTCG----TNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPECTNGGSNSN 251 LC CG ++ ++ C+N + + K +K TP E I+ +CPEC GG + Sbjct: 615 LCEKCGGEMVQKFSRNGAFLACNNYPECKNTKSLKNTPNAKETIEGVKCPEC--GGDIAL 672 Query: 250 KRVK 239 KR K Sbjct: 673 KRSK 676
>BAZ1B_HUMAN (Q9UIG0) Bromodomain adjacent to zinc finger domain protein 1B| (Williams-Beuren syndrome chromosome region 9 protein) (WBRS9) (Williams syndrome transcription factor) (hWALP2) Length = 1483 Score = 33.9 bits (76), Expect = 0.27 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = -1 Query: 427 DNTLCGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAE-HIKHYRCPECTNGGSNSN 251 +N C C G+D+ I CD C K +H C++ PA E ++CP C + N Sbjct: 1183 ENARCKVC-RKKGEDDKLILCDECNKAFHLFCLR--PALYEVPDGEWQCPACQPATARRN 1239 Query: 250 KR 245 R Sbjct: 1240 SR 1241
>JHD1_USTMA (Q4P5U1) JmjC domain-containing histone demethylation protein 1 (EC| 1.14.11.-) Length = 669 Score = 33.9 bits (76), Expect = 0.27 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -1 Query: 382 EFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPEC 275 E WICC +C+ W+H C+ I + + C C Sbjct: 90 ETWICCTHCKTWFH--CICIGLENPDDFSKWYCQPC 123
>DPF1_MOUSE (Q9QX66) Zinc-finger protein neuro-d4 (D4, zinc and double PHD| fingers family 1) Length = 387 Score = 33.9 bits (76), Expect = 0.27 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = -1 Query: 415 CGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAE 305 C CGT++ D+ + CD+C++ YH C ++P AE Sbjct: 328 CSLCGTSENDDQL-LFCDDCDRGYHMYC--LSPPMAE 361
>HRX_MOUSE (P55200) Zinc finger protein HRX (ALL-1) (Fragment)| Length = 3866 Score = 33.1 bits (74), Expect = 0.46 Identities = 15/58 (25%), Positives = 23/58 (39%), Gaps = 9/58 (15%) Frame = -1 Query: 418 LCGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIK---------HYRCPECT 272 LC C +D + + C C++W H KC ++ E + Y C CT Sbjct: 1470 LCDKCYDDDDYESKMMQCGKCDRWVHSKCESLSGTEDEMYEILSNLPESVAYTCVNCT 1527
>YCHD_SCHPO (Q9Y7V2) Protein C645.13 in chromosome III| Length = 721 Score = 33.1 bits (74), Expect = 0.46 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = -1 Query: 406 CGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPEC 275 C + + + W+ CD C+ W H CV + A + + Y C C Sbjct: 25 CKSQEDIGDTWVQCDGCDCWQHASCVGL--ADKDIPESYYCEVC 66
>PYGO2_HUMAN (Q9BRQ0) Pygopus homolog 2| Length = 406 Score = 33.1 bits (74), Expect = 0.46 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -1 Query: 415 CGTCGTNDGKDEFWICCD-NCEKWYHGKCVKIT 320 CG C + D+ I C+ +C+KW+H +C +T Sbjct: 330 CGACRSEVNDDQDAILCEASCQKWFHRECTGMT 362
>BAZ1B_MOUSE (Q9Z277) Bromodomain adjacent to zinc finger domain protein 1B| (Williams-Beuren syndrome chromosome region 9 protein homolog) (WBRS9) Length = 1479 Score = 33.1 bits (74), Expect = 0.46 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = -1 Query: 427 DNTLCGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAE-HIKHYRCPECTNGGSNSN 251 +N C C G+D+ I CD C K +H C++ PA E ++CP C + N Sbjct: 1183 ENARCKVC-RKKGEDDKLILCDECNKAFHLFCLR--PALYEVPDGEWQCPACQPPTARRN 1239 Query: 250 KR 245 R Sbjct: 1240 SR 1241
>REQUB_XENLA (Q9W636) Zinc-finger protein ubi-d4 B (Requiem B) (xReq B)| (Apoptosis response zinc finger protein B) (Fragment) Length = 366 Score = 33.1 bits (74), Expect = 0.46 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = -1 Query: 415 CGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAE 305 C CGT++ D+ + CD+C++ YH C ++P AE Sbjct: 307 CNICGTSENDDQL-LFCDDCDRGYHMYC--LSPPVAE 340
>YP99_CAEEL (Q09477) Hypothetical C28H8.9 in chromosome III| Length = 372 Score = 32.7 bits (73), Expect = 0.60 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = -1 Query: 415 CGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPA 314 C CGT++ D+ + CD+C++ YH C +TPA Sbjct: 314 CTICGTSENDDKL-LFCDDCDRGYHLYC--LTPA 344
>DPF3_CHICK (P58270) Zinc-finger protein DPF3 (cer-d4)| Length = 427 Score = 32.7 bits (73), Expect = 0.60 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -1 Query: 415 CGTCGTNDGKDEFWICCDNCEKWYHGKCV 329 C CGT++ D+ + CD+C++ YH C+ Sbjct: 368 CSLCGTSENDDQL-LFCDDCDRGYHMYCL 395
>REQUA_XENLA (Q9W638) Zinc-finger protein ubi-d4 A (Requiem A) (xReq A)| (Apoptosis response zinc finger protein A) Length = 388 Score = 32.7 bits (73), Expect = 0.60 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -1 Query: 415 CGTCGTNDGKDEFWICCDNCEKWYHGKCV 329 C CGT++ D+ + CD+C++ YH C+ Sbjct: 329 CNICGTSENDDQL-LFCDDCDRGYHMYCL 356
>CHD3_DROME (O16102) Chromodomain helicase-DNA-binding protein 3 (EC 3.6.1.-)| (ATP-dependent helicase Chd3) Length = 892 Score = 32.3 bits (72), Expect = 0.79 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = -1 Query: 427 DNTLCGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPEC 275 D C C +DG D +CCD+C YH C+ P ++ + CP C Sbjct: 34 DEEYCKVC--SDGGD--LLCCDSCPSVYHRTCLS-PPLKSIPKGDWICPRC 79
>UHRF1_HUMAN (Q96T88) Ubiquitin-like PHD and RING finger domain-containing| protein 1 (EC 6.3.2.-) (Ubiquitin-like-containing PHD and RING finger domains protein 1) (Inverted CCAAT box-binding protein of 90 kDa) (Transcription factor ICBP90) (Nuclear zinc Length = 793 Score = 32.3 bits (72), Expect = 0.79 Identities = 15/52 (28%), Positives = 22/52 (42%) Frame = -1 Query: 415 CGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPECTNGGS 260 C CG D+ + CD C+ +H C+ + + CPEC N S Sbjct: 318 CHLCGGRQDPDK-QLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRNDAS 368
>SET3_SCHPO (Q10362) SET domain-containing protein 3| Length = 859 Score = 32.0 bits (71), Expect = 1.0 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -1 Query: 385 DEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPEC 275 D F I C++CE W H CV I + Y C +C Sbjct: 14 DGFTIQCESCEVWQHAVCVNIDANNVP--EKYFCEQC 48
>NRDJ_STRCL (O54196) Vitamin B12-dependent ribonucleotide reductase (EC 1.17.4.1)| (Ribonucleoside-diphosphate reductase nrdJ) Length = 961 Score = 31.6 bits (70), Expect = 1.3 Identities = 16/54 (29%), Positives = 21/54 (38%) Frame = -1 Query: 517 AEPRAKAKVPAPKXXXXXXXXXXXXXXXEHDNTLCGTCGTNDGKDEFWICCDNC 356 A P A A++PAPK D LC +CGT + C+ C Sbjct: 901 AVPAAPAEIPAPKQAHTSAELVEMQLGISADAPLCFSCGTKMQRAGSCYICEGC 954
>ZMY11_MOUSE (Q8R5C8) Zinc finger MYND domain-containing protein 11| Length = 562 Score = 31.6 bits (70), Expect = 1.3 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -1 Query: 373 ICCDNCEKWYHGKCVKITPARAEHIKHYRCPECTN-GGSNSNKR 245 + CD C + YH KC+ + H++CP C + +SNK+ Sbjct: 73 LICDLCFRVYHSKCLSDEFRLRDSSSHWQCPVCRSIKKKHSNKQ 116
>PHF14_HUMAN (O94880) PHD finger protein 14| Length = 888 Score = 30.8 bits (68), Expect = 2.3 Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 3/56 (5%) Frame = -1 Query: 415 CGTCGTNDGKDEFWICCDNCEKWYHGKCVK---ITPARAEHIKHYRCPECTNGGSN 257 CG C N + + CD C+ YH C+ R +++C EC GS+ Sbjct: 728 CGICKKNHDQ-HLLLLCDTCKLHYHLGCLDPPLTRMPRKTKNSYWQCSECDQAGSS 782
>PYGO1_MOUSE (Q9D0P5) Pygopus homolog 1| Length = 417 Score = 30.8 bits (68), Expect = 2.3 Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = -1 Query: 415 CGTCGTNDGKDEFWICCD-NCEKWYHGKCVKIT 320 CG C D+ I C+ +C+KW+H C +T Sbjct: 341 CGICTNEVNDDQDAILCEASCQKWFHRICTGMT 373
>PHF14_MOUSE (Q9D4H9) PHD finger protein 14| Length = 881 Score = 30.8 bits (68), Expect = 2.3 Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 3/56 (5%) Frame = -1 Query: 415 CGTCGTNDGKDEFWICCDNCEKWYHGKCVK---ITPARAEHIKHYRCPECTNGGSN 257 CG C N + + CD C+ YH C+ R +++C EC GS+ Sbjct: 721 CGICKKNHDQ-HLLLLCDTCKLHYHLGCLDPPLTRMPRKTKNSYWQCSECDQAGSS 775
>JHD1_KLULA (Q6CIC9) JmjC domain-containing histone demethylation protein 1 (EC| 1.14.11.-) Length = 478 Score = 30.8 bits (68), Expect = 2.3 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 3/34 (8%) Frame = -1 Query: 415 CGTCGTNDGKDE---FWICCDNCEKWYHGKCVKI 323 C C +D +D+ W+ C+ C+ W H CV I Sbjct: 8 CHFCKKDDSEDKGQPIWVGCEFCDGWCHLTCVPI 41
>DPF1_CHICK (P58267) Zinc-finger protein neuro-d4 (D4, zinc and double PHD| fingers family 1) Length = 380 Score = 30.8 bits (68), Expect = 2.3 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -1 Query: 415 CGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAE 305 C CG+ + DE + CD+C++ YH C I+P AE Sbjct: 321 CSLCGSAEN-DEQLLFCDDCDRGYHMYC--ISPPVAE 354
>PYGO1_HUMAN (Q9Y3Y4) Pygopus homolog 1| Length = 419 Score = 30.8 bits (68), Expect = 2.3 Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = -1 Query: 415 CGTCGTNDGKDEFWICCD-NCEKWYHGKCVKIT 320 CG C D+ I C+ +C+KW+H C +T Sbjct: 343 CGICTNEVNDDQDAILCEASCQKWFHRICTGMT 375
>JAD1C_HUMAN (P41229) Jumonji/ARID domain-containing protein 1C (SmcX protein)| (Xe169 protein) Length = 1560 Score = 30.8 bits (68), Expect = 2.3 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 367 CDNCEKWYHGKCVKI 323 CD C+ W+HG+CV + Sbjct: 1202 CDLCQDWFHGRCVSV 1216
>JAD1D_HUMAN (Q9BY66) Jumonji/ARID domain-containing protein 1D (SmcY protein)| (Histocompatibility Y antigen) (H-Y) Length = 1539 Score = 30.4 bits (67), Expect = 3.0 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 367 CDNCEKWYHGKCVKI 323 CD C+ W+HG+CV + Sbjct: 1189 CDLCQDWFHGQCVSV 1203
>JAD1D_PANTR (Q5XUN4) Jumonji/ARID domain-containing protein 1D (SmcY protein)| Length = 1535 Score = 30.4 bits (67), Expect = 3.0 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 367 CDNCEKWYHGKCVKI 323 CD C+ W+HG+CV + Sbjct: 1189 CDLCQDWFHGQCVSV 1203
>TRX_DROME (P20659) Protein trithorax| Length = 3726 Score = 30.4 bits (67), Expect = 3.0 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = -1 Query: 421 TLCGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPECTNGGSNSNKRV 242 T+C TC + G + C C+K YH C+ + + C C S S +V Sbjct: 1345 TVCYTCNMSSGSK---VKCQKCQKNYHSTCLGTSKRLLGADRPLICVNCLKCKSCSTTKV 1401 Query: 241 KT*AGWAP 218 G P Sbjct: 1402 SKFVGNLP 1409
>JHD1_ASPFU (Q4WHB7) JmjC domain-containing histone demethylation protein 1 (EC| 1.14.11.-) Length = 1418 Score = 30.4 bits (67), Expect = 3.0 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 385 DEFWICCDNCEKWYHGKC 332 D WI CD C++W+H C Sbjct: 351 DVTWISCDGCKQWFHIVC 368
>JAD1C_MOUSE (P41230) Jumonji/ARID domain-containing protein 1C (SmcX protein)| (Xe169 protein) Length = 1554 Score = 30.4 bits (67), Expect = 3.0 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 367 CDNCEKWYHGKCVKI 323 CD C+ W+HG+CV + Sbjct: 1202 CDLCQDWFHGRCVTV 1216
>SET3_YEAST (P36124) SET domain protein 3| Length = 751 Score = 30.4 bits (67), Expect = 3.0 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -1 Query: 406 CGTNDGKDEFWICCDNCEKWYHGKCVKI 323 C ND D F I CD+C +W H C I Sbjct: 122 CDLNDD-DGFTIQCDHCNRWQHAICYGI 148
>DPF1_RAT (P56163) Zinc-finger protein neuro-d4 (D4, zinc and double PHD| fingers family 1) Length = 397 Score = 30.4 bits (67), Expect = 3.0 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 9/46 (19%) Frame = -1 Query: 415 CGTCGTNDGKDEFW---------ICCDNCEKWYHGKCVKITPARAE 305 C CGT++ W + CD+C++ YH C ++P AE Sbjct: 328 CSLCGTSENDGASWAGLTPQDQLLFCDDCDRGYHMYC--LSPPMAE 371
>ZSCA2_MOUSE (Q07230) Zinc finger and SCAN domain-containing protein 2 (Zinc| finger protein 29) (Zfp-29) Length = 614 Score = 30.4 bits (67), Expect = 3.0 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = -1 Query: 367 CDNCEKWYHGKCVKITPARAEH-IKHYRCPECTNGGSNSN 251 C C K + V I R K YRCPEC G SNS+ Sbjct: 560 CPECGKGFSWNSVLIIHQRIHTGEKPYRCPECGKGFSNSS 599
>DPF1_HUMAN (Q92782) Zinc-finger protein neuro-d4 (D4, zinc and double PHD| fingers family 1) Length = 353 Score = 30.4 bits (67), Expect = 3.0 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 9/46 (19%) Frame = -1 Query: 415 CGTCGTNDGKDEFW---------ICCDNCEKWYHGKCVKITPARAE 305 C CGT++ W + CD+C++ YH C ++P AE Sbjct: 284 CSLCGTSENDGASWAGLTPQDQLLFCDDCDRGYHMYC--LSPPMAE 327
>ASR1_ASHGO (Q75DC2) Alcohol-sensitive RING finger protein 1| Length = 328 Score = 30.0 bits (66), Expect = 3.9 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -1 Query: 415 CGTCGTNDGKDEFWICCDNCEKWYHGKCV 329 CG CG +G + CC+ C YH C+ Sbjct: 129 CGICGEMNGDID--TCCNRCHHMYHHSCL 155
>ZN214_HUMAN (Q9UL59) Zinc finger protein 214 (BWSCR2-associated zinc-finger| protein 1) (BAZ 1) Length = 606 Score = 30.0 bits (66), Expect = 3.9 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -1 Query: 367 CDNCEKWY-HGKCVKITPARAEHIKHYRCPECTNGGSNSNK 248 CD+C K + H ++I K Y CPEC G S S+K Sbjct: 444 CDDCGKDFSHSSDLRIHQRVHTGEKPYTCPECGKGFSKSSK 484
>BAZ1A_XENLA (Q8UVR5) Bromodomain adjacent to zinc finger domain 1A| (ATP-utilizing chromatin assembly and remodely factor 1) (xACF1) (Fragment) Length = 627 Score = 30.0 bits (66), Expect = 3.9 Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -1 Query: 424 NTLCGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKH--YRCPEC 275 N C C G E + CD C++ +H CV+ + +++ + CPEC Sbjct: 222 NARCKVC-RKKGDGESMVLCDGCDRGHHIYCVR---PKLKYVPEGDWFCPEC 269
>UHRF2_HUMAN (Q96PU4) Ubiquitin-like PHD and RING finger domain-containing| protein 2 (EC 6.3.2.-) (Ubiquitin-like-containing PHD and RING finger domains protein 2) (Np95/ICBP90-like RING finger protein) (Np95-like RING finger protein) (Nuclear zinc finger Length = 802 Score = 30.0 bits (66), Expect = 3.9 Identities = 16/54 (29%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = -1 Query: 415 CGTCGTNDGKDE--FWICCDNCEKWYHGKCVKITPARAEHIKHYRCPECTNGGS 260 C CG GK E + CD C YH C+ + +++ CP C S Sbjct: 347 CRVCG---GKHEPNMQLLCDECNVAYHIYCLNPPLDKVPEEEYWYCPSCKTDSS 397
>JAD1D_MOUSE (Q62240) Jumonji/ARID domain-containing protein 1D (SmcY protein)| (Histocompatibility Y antigen) (H-Y) Length = 1548 Score = 30.0 bits (66), Expect = 3.9 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = -1 Query: 367 CDNCEKWYHGKCVKI----TPARAEH 302 CD C W+HG+CV + + RA H Sbjct: 1197 CDLCHDWFHGQCVTVPHLLSSVRASH 1222
>YNG2_CANAL (Q5AHB8) Chromatin modification-related protein YNG2 (ING1 homolog| 2) Length = 298 Score = 30.0 bits (66), Expect = 3.9 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 4/49 (8%) Frame = -1 Query: 373 ICCDN--CE-KWYHGKCVKIT-PARAEHIKHYRCPECTNGGSNSNKRVK 239 I CDN C+ +W+H CV IT P + + I + CP+C + K+ K Sbjct: 251 IGCDNEDCKYEWFHWSCVGITSPPKDDEI--WYCPDCASKMEKRKKKRK 297
>VIT5_CAEEL (P06125) Vitellogenin 5 precursor| Length = 1603 Score = 29.6 bits (65), Expect = 5.1 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -1 Query: 424 NTLCGTCGTNDG-KDEFWICCDNCE 353 N LCG CG NDG +D ++ DN E Sbjct: 1432 NQLCGLCGNNDGERDNEFMTADNYE 1456
>VIT4_CAEEL (P18947) Vitellogenin 4 precursor| Length = 1603 Score = 29.6 bits (65), Expect = 5.1 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -1 Query: 424 NTLCGTCGTNDG-KDEFWICCDNCE 353 N LCG CG NDG +D ++ DN E Sbjct: 1432 NQLCGLCGNNDGERDNEFMTADNYE 1456
>VIT3_CAEEL (Q9N4J2) Vitellogenin 3 precursor| Length = 1603 Score = 29.6 bits (65), Expect = 5.1 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -1 Query: 424 NTLCGTCGTNDG-KDEFWICCDNCE 353 N LCG CG NDG +D ++ DN E Sbjct: 1432 NQLCGLCGNNDGERDNEFMTADNYE 1456
>CHD4_MOUSE (Q6PDQ2) Chromodomain helicase-DNA-binding protein 4 (CHD-4)| Length = 1915 Score = 29.6 bits (65), Expect = 5.1 Identities = 17/53 (32%), Positives = 21/53 (39%) Frame = -1 Query: 430 HDNTLCGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPECT 272 H C C DG + +CCD C YH C+ P + CP CT Sbjct: 440 HHMEFCRVC--KDGGE--LLCCDTCPSSYHIHCLN-PPLPEIPNGEWLCPRCT 487
>CHD4_HUMAN (Q14839) Chromodomain helicase-DNA-binding protein 4 (EC 3.6.1.-)| (ATP-dependent helicase CHD4) (CHD-4) (Mi-2 autoantigen 218 kDa protein) (Mi2-beta) Length = 1912 Score = 29.6 bits (65), Expect = 5.1 Identities = 17/53 (32%), Positives = 21/53 (39%) Frame = -1 Query: 430 HDNTLCGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPECT 272 H C C DG + +CCD C YH C+ P + CP CT Sbjct: 447 HHMEFCRVC--KDGGE--LLCCDTCPSSYHIHCLN-PPLPEIPNGEWLCPRCT 494
>UHRF1_MOUSE (Q8VDF2) Ubiquitin-like PHD and RING finger domain-containing| protein 1 (EC 6.3.2.-) (Ubiquitin-like-containing PHD and RING finger domains protein 1) (Nuclear zinc finger protein Np95) (Nuclear protein 95) Length = 782 Score = 29.6 bits (65), Expect = 5.1 Identities = 13/52 (25%), Positives = 21/52 (40%) Frame = -1 Query: 415 CGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPECTNGGS 260 C CG + ++ + CD C+ +H C+K + CP C S Sbjct: 323 CHVCGGREAPEK-QLLCDECDMAFHLYCLKPPLTSVPPEPEWYCPSCRTDSS 373
>CHDM_DROME (O97159) Chromodomain helicase-DNA-binding protein Mi-2 homolog (EC| 3.6.1.-) (ATP-dependent helicase Mi-2) (dMi-2) Length = 1982 Score = 29.6 bits (65), Expect = 5.1 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -1 Query: 373 ICCDNCEKWYHGKCVKITPARAEHIKHYRCPECT 272 +CCD+C YH C+ P +RCP C+ Sbjct: 450 LCCDSCPSAYHTFCLN-PPLDTIPDGDWRCPRCS 482
>HBXAP_HUMAN (Q96T23) Hepatitis B virus X-associated protein (HBV pX-associated| protein 8) (Remodeling and spacing factor 1) (Rsf-1) (p325 subunit of RSF chromatin remodelling complex) Length = 1431 Score = 29.3 bits (64), Expect = 6.7 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = -1 Query: 427 DNTLCGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPEC 275 D+ C CG + E + CD+C+ YH C++ P + CP C Sbjct: 880 DDEPCKKCGLPN-HPELILLCDSCDSGYHTACLR-PPLMIIPDGEWFCPPC 928
>ZSCA2_HUMAN (Q7Z7L9) Zinc finger and SCAN domain-containing protein 2 (Zinc| finger protein 29 homolog) (Zfp-29) Length = 613 Score = 29.3 bits (64), Expect = 6.7 Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = -1 Query: 367 CDNCEKWYHGKCVKITPARAEH-IKHYRCPECTNGGSNSN 251 C C K + V I R K Y+CPEC G SNS+ Sbjct: 559 CPECGKGFSWNSVLIIHQRIHTGEKPYKCPECGKGFSNSS 598
>BAZ1A_HUMAN (Q9NRL2) Bromodomain adjacent to zinc finger domain protein 1A| (ATP-utilizing chromatin assembly and remodeling factor 1) (hACF1) (ATP-dependent chromatin remodelling protein) (Williams syndrome transcription factor-related chromatin remodeli Length = 1556 Score = 29.3 bits (64), Expect = 6.7 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = -1 Query: 424 NTLCGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPEC 275 N C C G E + CD C++ +H CV+ + + CPEC Sbjct: 1148 NARCKIC-RKKGDAENMVLCDGCDRGHHTYCVR-PKLKTVPEGDWFCPEC 1195
>TRX_DROVI (Q24742) Protein trithorax| Length = 3828 Score = 29.3 bits (64), Expect = 6.7 Identities = 17/68 (25%), Positives = 26/68 (38%) Frame = -1 Query: 421 TLCGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPECTNGGSNSNKRV 242 T+C TC + G + C C+K YH C+ + + C C S + +V Sbjct: 1332 TVCYTCNMSSGSK---VKCQKCQKNYHSTCLGTSKRLLGADRPLICVNCLKCKSCATTKV 1388 Query: 241 KT*AGWAP 218 G P Sbjct: 1389 SKFVGNLP 1396
>NSD1_MOUSE (O88491) Histone-lysine N-methyltransferase, H3 lysine-36 and H4| lysine-20 specific (EC 2.1.1.43) (H3-K36-HMTase) (H4-K20-HMTase) (Nuclear receptor binding SET domain containing protein 1) (NR-binding SET domain containing protein) Length = 2588 Score = 29.3 bits (64), Expect = 6.7 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 Query: 358 CEKWYHGKCVKITPARAEHIKHYRCP 281 C K+YH +CV+ P K +RCP Sbjct: 1509 CGKFYHEECVQKYPPTVTQNKGFRCP 1534
>PHF20_MOUSE (Q8BLG0) PHD finger protein 20 (Hepatocellular carcinoma-associated| antigen 58 homolog) Length = 1010 Score = 28.9 bits (63), Expect = 8.7 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = -1 Query: 388 KDEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPEC 275 +++F I C+ C+ W HG C+ + + Y C C Sbjct: 665 ENDFMIQCEECQCWQHGVCMGLLEENVP--EKYTCYVC 700
>MLO2_SCHPO (Q09329) Protein mlo2| Length = 329 Score = 28.9 bits (63), Expect = 8.7 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 5/54 (9%) Frame = -1 Query: 418 LCGTCGTNDGKDEFWICCDNCEKWYHGKCVK-----ITPARAEHIKHYRCPECT 272 +C T + ++ C CE W+H KC++ I AE + C EC+ Sbjct: 124 ICDTVYNPETEEGTMFQCILCEDWFHEKCLQKTNKGIAIPDAETFEWLVCSECS 177
>YKI5_CAEEL (P46012) Hypothetical protein C01G6.5| Length = 952 Score = 28.9 bits (63), Expect = 8.7 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = -1 Query: 376 WICCDNCEKWYHGKCVKITPARAEHIKHYRCPECTNGGSNSNKRVK 239 W+ C C +W+H CV++ + + C C GS+ +K K Sbjct: 886 WVSCSICNQWFHVWCVRLDNVCYREDETFLC--C---GSHPSKEAK 926
>SAYP_DROME (Q9VWF2) Supporter of activation of yellow protein (Protein enhancer| of yellow 3) Length = 2006 Score = 28.9 bits (63), Expect = 8.7 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 7/54 (12%) Frame = -1 Query: 415 CGTCGTNDGKD-----EFWICCDNCEKWYHGKCVKITPARAEHIKHY--RCPEC 275 CG C + ++ E +I C C K H CV + P +++Y +C C Sbjct: 1695 CGVCLRSQHRNARDMPEAFIRCYTCRKRVHPSCVDMPPRMVGRVRNYNWQCAGC 1748
>AIRE_HUMAN (O43918) Autoimmune regulator (Autoimmune polyendocrinopathy| candidiasis ectodermal dystrophy protein) (APECED protein) Length = 545 Score = 28.9 bits (63), Expect = 8.7 Identities = 16/47 (34%), Positives = 21/47 (44%) Frame = -1 Query: 415 CGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPEC 275 C C DG + ICCD C + +H C+ P R +RC C Sbjct: 299 CAVC--RDGGE--LICCDGCPRAFHLACLS-PPLREIPSGTWRCSSC 340
>YNG2_DEBHA (Q6BNL6) Chromatin modification-related protein YNG2 (ING1 homolog| 2) Length = 285 Score = 28.9 bits (63), Expect = 8.7 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = -1 Query: 373 ICCDNCE---KWYHGKCVKIT-PARAEHIKHYRCPECTNGGSNSNKRVK 239 I CDN + +W+H CV IT P + + I + CP+C K+ K Sbjct: 239 IGCDNDDCKFEWFHWSCVGITAPPKDDEI--WYCPDCAPKMEKRKKKRK 285
>PHF20_HUMAN (Q9BVI0) PHD finger protein 20 (Hepatocellular carcinoma-associated| antigen 58) (Glioma-expressed antigen 2) (Transcription factor TZP) (Novel zinc finger protein) Length = 1012 Score = 28.9 bits (63), Expect = 8.7 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = -1 Query: 388 KDEFWICCDNCEKWYHGKCVKITPARAEHIKHYRCPEC 275 +++F I C+ C+ W HG C+ + + Y C C Sbjct: 662 ENDFMIQCEECQCWQHGVCMGLLEENVP--EKYTCYVC 697 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,571,914 Number of Sequences: 219361 Number of extensions: 911643 Number of successful extensions: 2613 Number of sequences better than 10.0: 102 Number of HSP's better than 10.0 without gapping: 2454 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2604 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3869946934 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
