Clone Name | rbart28b11 |
---|---|
Clone Library Name | barley_pub |
>PER9_ARATH (Q96512) Peroxidase 9 precursor (EC 1.11.1.7) (Atperox P9) (ATP18a)| Length = 346 Score = 33.5 bits (75), Expect = 0.35 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -2 Query: 509 GRTDWAVKGLAENKWWFYGQFRDSMVKLSQYQP-GGNVGEIRRNSCFAPN 363 G+T VK AE++ F+ QF SMV + QP G GEIR+ SC N Sbjct: 298 GKTGALVKAYAEDERLFFQQFAKSMVNMGNIQPLTGFNGEIRK-SCHVIN 346
>PER36_ARATH (Q9SD46) Peroxidase 36 precursor (EC 1.11.1.7) (Atperox P36)| Length = 336 Score = 32.3 bits (72), Expect = 0.79 Identities = 19/37 (51%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -2 Query: 491 VKGLAENKWWFYGQFRDSMVKLSQYQP-GGNVGEIRR 384 VK AEN+ F+ QF SMVK+ P G GEIRR Sbjct: 291 VKYYAENEGAFFEQFAKSMVKMGNISPLTGTDGEIRR 327
>PER66_ARATH (Q9LT91) Peroxidase 66 precursor (EC 1.11.1.7) (Atperox P66)| (ATP27a) Length = 322 Score = 32.3 bits (72), Expect = 0.79 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = -2 Query: 512 DGRTDWAVKGLAENKWWFYGQFRDSMVKLSQYQPGGNVGEIRRNSCF 372 D RT W V+ A+++ F+ +F SMVKL + G++R N+ F Sbjct: 275 DSRTKWIVETFAQDQKAFFREFAASMVKLGNFGV-KETGQVRVNTRF 320
>PER3_ARMRU (P17180) Peroxidase C3 precursor (EC 1.11.1.7)| Length = 349 Score = 30.4 bits (67), Expect = 3.0 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -2 Query: 479 AENKWWFYGQFRDSMVKLSQYQP-GGNVGEIRRNSCFAPNGR 357 + N + F+G F D+M+++ +P G GEIR+N C N R Sbjct: 295 SSNTFAFFGAFVDAMIRMGNLRPLTGTQGEIRQN-CRVVNSR 335
>PERE5_ARMRU (P59121) Peroxidase E5 (EC 1.11.1.7)| Length = 306 Score = 30.0 bits (66), Expect = 3.9 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -2 Query: 479 AENKWWFYGQFRDSMVKLSQYQP-GGNVGEIRRNSCFAPNGR 357 + N F+G F D+M+++ +P G GEIR+N C N R Sbjct: 266 SSNTLSFFGAFADAMIRMGNLRPLTGTQGEIRQN-CRVVNSR 306
>PER23_ARATH (O80912) Peroxidase 23 precursor (EC 1.11.1.7) (Atperox P23)| (ATP34) Length = 349 Score = 30.0 bits (66), Expect = 3.9 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = -2 Query: 491 VKGLAENKWWFYGQFRDSMVKLSQYQP-GGNVGEIRRNSCFAPNGR 357 V + N + F+G F D+M+++ +P G GEIR+N C N R Sbjct: 291 VNQYSSNTFVFFGAFVDAMIRMGNLKPLTGTQGEIRQN-CRVVNPR 335
>PER72_ARATH (Q9FJZ9) Peroxidase 72 precursor (EC 1.11.1.7) (Atperox P72)| (PRXR8) (ATP6a) Length = 336 Score = 29.6 bits (65), Expect = 5.1 Identities = 17/33 (51%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -2 Query: 479 AENKWWFYGQFRDSMVKLSQYQP-GGNVGEIRR 384 AEN+ F+ QF SMVK+ P G GEIRR Sbjct: 295 AENQEAFFEQFAKSMVKMGNISPLTGAKGEIRR 327
>PER52_ARATH (Q9FLC0) Peroxidase 52 precursor (EC 1.11.1.7) (Atperox P52)| (ATP49) Length = 324 Score = 29.6 bits (65), Expect = 5.1 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -2 Query: 509 GRTDWAVKGLAENKWWFYGQFRDSMVKLSQYQP-GGNVGEIRR 384 G TD V+G + N F F +M+K+ P G+ GEIR+ Sbjct: 276 GSTDSIVRGYSNNPSSFNSDFTAAMIKMGDISPLTGSSGEIRK 318
>RL15_MYCH2 (Q601J6) 50S ribosomal protein L15| Length = 147 Score = 28.9 bits (63), Expect = 8.7 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Frame = +1 Query: 31 PYFKRVPRHHERGLNEAEYTLLTLT---TRKQNDDLV 132 P+F+RVP+ R N+ EY + L+ +R Q+ D V Sbjct: 56 PWFRRVPKRGFRNFNKKEYEIFNLSDLESRYQDGDTV 92 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,631,302 Number of Sequences: 219361 Number of extensions: 1603260 Number of successful extensions: 3883 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3654 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3881 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3869946934 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)