Clone Name | rbart28b08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PATR_THEFY (Q47KH1) Putative phenylalanine aminotransferase (EC ... | 30 | 4.6 | 2 | ATPBM_CHLRE (P38482) ATP synthase beta chain, mitochondrial prec... | 29 | 7.8 |
---|
>PATR_THEFY (Q47KH1) Putative phenylalanine aminotransferase (EC 2.6.1.-)| Length = 359 Score = 29.6 bits (65), Expect = 4.6 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = -1 Query: 178 ERQANPGGLAAMPWVAMELYSTLPGLAGV--LSVPVLPSVYDL 56 E A PG W + E Y L GLAG + VP+ +DL Sbjct: 100 EATAEPGAEVVYAWRSFEAYPLLTGLAGATPIHVPLREETHDL 142
>ATPBM_CHLRE (P38482) ATP synthase beta chain, mitochondrial precursor (EC| 3.6.3.14) Length = 574 Score = 28.9 bits (63), Expect = 7.8 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = +3 Query: 213 RRLLLLASPAIVPWWWLNQARCHNLVMLPLRHARPLACSFVWSSWDEAPQ 362 ++++ SP VP R N++ P+ P+ CS VWS EAP+ Sbjct: 100 QKVVNTGSPIKVPVGRGTLGRIMNVIGEPVDEQGPIECSEVWSIHREAPE 149 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,770,321 Number of Sequences: 219361 Number of extensions: 1709915 Number of successful extensions: 4149 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4027 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4148 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)