| Clone Name | rbart28b02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DCR1_DROME (Q9VCU9) Endoribonuclease Dcr-1 (EC 3.1.26.-) (Protei... | 30 | 3.6 | 2 | CPRF1_PETCR (Q99089) Common plant regulatory factor CPRF-1 | 29 | 7.9 |
|---|
>DCR1_DROME (Q9VCU9) Endoribonuclease Dcr-1 (EC 3.1.26.-) (Protein dicer-1)| Length = 2249 Score = 30.0 bits (66), Expect = 3.6 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 2/63 (3%) Frame = +1 Query: 34 DRNDNRVHRKYTQNPLSI*--PKWSGNSRTVQSGSRTCTKPTTTRRSSKEKRDGTDNQCI 207 DR NR + T P PK S + T Q +R + TRR ++ DG+D C Sbjct: 439 DRQTNRSAARVTPTPTPAHAKPKPSSGANTAQPRTR---RRVYTRRHHRDHNDGSDTLCA 495 Query: 208 IVH 216 +++ Sbjct: 496 LIY 498
>CPRF1_PETCR (Q99089) Common plant regulatory factor CPRF-1| Length = 411 Score = 28.9 bits (63), Expect = 7.9 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +2 Query: 83 LYNQNGAVIHVQYRAEAEHALNQPLPADHQKKNGTGRTTNASSYIKN 223 L N N ++ V A+AE A + L +++KK T T N S + N Sbjct: 325 LTNDNSRLLEVMKNAQAERAADVGLGNNNEKKASTLSTANLLSRVDN 371 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,465,759 Number of Sequences: 219361 Number of extensions: 908264 Number of successful extensions: 2528 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2483 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2528 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3523384522 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)