Clone Name | rbart28a10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YH17_YEAST (P38898) Hypothetical 17.1 kDa protein in PUR5 3'region | 27 | 4.0 | 2 | ENVE_SALTY (Q56030) Probable lipoprotein envE precursor | 28 | 7.6 | 3 | LPLA_YERPE (Q8ZDY2) Lipoate-protein ligase A (EC 6.3.2.-) | 28 | 7.6 | 4 | RL14_DROME (P55841) 60S ribosomal protein L14 | 28 | 9.9 |
---|
>YH17_YEAST (P38898) Hypothetical 17.1 kDa protein in PUR5 3'region| Length = 153 Score = 26.6 bits (57), Expect(2) = 4.0 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +2 Query: 47 QSSDLRIMVP-PHSLQHPLLPRSNADSIAREHTQTPLPH 160 Q SD+ I P PH HP P HT TP PH Sbjct: 13 QYSDIYIHTPHPHPHPHPHTPTHT-----HPHTPTPTPH 46 Score = 21.6 bits (44), Expect(2) = 4.0 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 147 HHCHTSHTVL 176 HH HT HT L Sbjct: 63 HHTHTPHTTL 72
>ENVE_SALTY (Q56030) Probable lipoprotein envE precursor| Length = 173 Score = 28.5 bits (62), Expect = 7.6 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 432 DKAHGGVHDGTEVVLWKWCEGDNQRW 355 D A G +GT ++L+ DNQRW Sbjct: 103 DAAGQGTKEGTPIILYSCTGNDNQRW 128
>LPLA_YERPE (Q8ZDY2) Lipoate-protein ligase A (EC 6.3.2.-)| Length = 338 Score = 28.5 bits (62), Expect = 7.6 Identities = 15/52 (28%), Positives = 31/52 (59%) Frame = +2 Query: 272 LVPGLIHGDVSMAMQQISWYSIYQGRIFQRWLSPSHHFQSTTSVPSWTPPWA 427 L+PG+ HG + A++Q ++++ Y ++ +SP QS ++P +T +A Sbjct: 191 LLPGIDHGKIRTAIEQ-AFFAYYDEQVSAEVISP----QSLPNLPGFTEQFA 237
>RL14_DROME (P55841) 60S ribosomal protein L14| Length = 166 Score = 28.1 bits (61), Expect = 9.9 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -3 Query: 402 TEVVLWKWCEGD-NQRWKILPW*MLYQEIC 316 T +V W E D +WK+ PW + Q IC Sbjct: 70 TRIVRKAWTESDLKAQWKVSPWSVKAQNIC 99 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,664,594 Number of Sequences: 219361 Number of extensions: 782924 Number of successful extensions: 2742 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2659 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2742 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)