| Clone Name | rbart27g02 |
|---|---|
| Clone Library Name | barley_pub |
>NUS1_ASPOR (P24021) Nuclease S1 precursor (EC 3.1.30.1) (Endonuclease S1)| (Single-stranded-nucleate endonuclease) (Deoxyribonuclease S1) Length = 287 Score = 31.2 bits (69), Expect = 1.7 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = -2 Query: 380 LGDEYYFKALPVVQKRLAQGGVRLAAILNRIFS 282 L EYY K+ PV ++ +A+ G RLAA L+ I S Sbjct: 252 LSGEYYDKSQPVFEELIAKAGYRLAAWLDLIAS 284
>PURA_STRAW (Q82ER6) Adenylosuccinate synthetase (EC 6.3.4.4) (IMP--aspartate| ligase) (AdSS) (AMPSase) Length = 427 Score = 30.8 bits (68), Expect = 2.2 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -2 Query: 101 FYLHVLPQQIIVPICTYV*GDVLLIDTIVSFS 6 + LH+LP I+ P CT V G+ +++D V FS Sbjct: 50 YALHLLPSGILTPECTPVIGNGVVVDPSVLFS 81
>LPHN2_RAT (O88923) Latrophilin-2 precursor (Calcium-independent| alpha-latrotoxin receptor 2) (CIRL-2) Length = 1487 Score = 30.4 bits (67), Expect = 2.8 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 455 RSWFCCGTPPTASPH 499 R W+CCG PT SPH Sbjct: 1128 RHWYCCGGLPTESPH 1142
>LPHN2_MOUSE (Q8JZZ7) Latrophilin-2 (Calcium-independent alpha-latrotoxin| receptor 2) (Fragment) Length = 891 Score = 30.4 bits (67), Expect = 2.8 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 455 RSWFCCGTPPTASPH 499 R W+CCG PT SPH Sbjct: 575 RHWYCCGGLPTESPH 589
>NUP3_PENSQ (P24504) Nuclease PA3 (EC 3.1.3.6) (Endonuclease PA3)| (Deoxyribonuclease PA3) Length = 270 Score = 30.0 bits (66), Expect = 3.7 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 4/65 (6%) Frame = -2 Query: 470 SKTTTCAEKYAQESAVLACDAY----EGVEQDDTLGDEYYFKALPVVQKRLAQGGVRLAA 303 S+ T A ++A ++ L C Q L YY + ++ ++A+GG RLA Sbjct: 199 SEPITTATRWASDANALVCTVVMPHGAAALQTGDLYPTYYDSVIDTIELQIAKGGYRLAN 258 Query: 302 ILNRI 288 +N I Sbjct: 259 WINEI 263
>NUP1_PENCI (P24289) Nuclease P1 (EC 3.1.30.1) (Endonuclease P1)| (Deoxyribonuclease P1) Length = 270 Score = 30.0 bits (66), Expect = 3.7 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 4/65 (6%) Frame = -2 Query: 470 SKTTTCAEKYAQESAVLACDAY----EGVEQDDTLGDEYYFKALPVVQKRLAQGGVRLAA 303 S+ T A ++A ++ L C Q L YY + ++ ++A+GG RLA Sbjct: 199 SEPITTATRWASDANALVCTVVMPHGAAALQTGDLYPTYYDSVIDTIELQIAKGGYRLAN 258 Query: 302 ILNRI 288 +N I Sbjct: 259 WINEI 263
>PURA_STRCO (Q9X8P6) Adenylosuccinate synthetase (EC 6.3.4.4) (IMP--aspartate| ligase) (AdSS) (AMPSase) Length = 427 Score = 29.6 bits (65), Expect = 4.8 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -2 Query: 101 FYLHVLPQQIIVPICTYV*GDVLLIDTIVSFS 6 + LH+LP I+ P CT V G+ +++D V FS Sbjct: 50 YALHLLPSGILSPGCTPVIGNGVVVDPSVLFS 81
>DDHD1_MOUSE (Q80YA3) Probable phospholipase DDHD1 (EC 3.1.1.-) (DDHD domain| protein 1) (Phosphatidic acid-preferring phospholipase A1 homolog) (PA-PLA1) Length = 547 Score = 29.6 bits (65), Expect = 4.8 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +3 Query: 240 TKFYRSDALQPAVPAEDPVEDRRQPHA 320 ++F RS A QP+ P++D +ED ++P A Sbjct: 410 SRFGRSSASQPSEPSKDSLEDDKKPSA 436
>CHD6_HUMAN (Q8TD26) Chromodomain-helicase-DNA-binding protein 6 (EC 3.6.1.-)| (ATP-dependent helicase CHD6) (CHD-6) (Radiation-induced gene B protein) Length = 2715 Score = 28.9 bits (63), Expect = 8.2 Identities = 29/108 (26%), Positives = 43/108 (39%), Gaps = 8/108 (7%) Frame = +3 Query: 54 RTYRYNDLLRQYV*IERFPAAANLKPFWWMDNKSNLELGDFGEATTLVRQDDLIIHCSPF 233 R+ R ND R+Y+ E F NL F W K L G F + + D+ + C Sbjct: 1081 RSRRLNDKARRYLRAECFRVEKNLLIFGWGRWKDILTHGRF---KWHLNEKDMEMICRAL 1137 Query: 234 I--STKFYRSD------ALQPAVPAEDPVEDRRQPHAPLSEPLLNDRQ 353 + K Y+ D + P +D Q H+ LS P+ R+ Sbjct: 1138 LVYCVKHYKGDEKIKSFIWELITPTKDGQAQTLQNHSGLSAPVPRGRK 1185 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,146,305 Number of Sequences: 219361 Number of extensions: 1068943 Number of successful extensions: 3355 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3300 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3355 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)