Clone Name | rbart27e09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | VL1_HPV27 (P36736) Major capsid protein L1 | 28 | 4.0 | 2 | VL1_HPV2A (P25486) Major capsid protein L1 | 28 | 4.0 | 3 | EXON_SHV21 (Q01013) Alkaline exonuclease (EC 3.1.11.-) | 27 | 8.8 |
---|
>VL1_HPV27 (P36736) Major capsid protein L1| Length = 594 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -1 Query: 105 NDTAISSLMLEETLMLPHGGRVYLPPICFNK 13 ND +S++ L+ L P+ +VYLPP +K Sbjct: 99 NDVNVSTISLQMALWRPNESKVYLPPTPVSK 129
>VL1_HPV2A (P25486) Major capsid protein L1| Length = 510 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -1 Query: 105 NDTAISSLMLEETLMLPHGGRVYLPPICFNK 13 ND +S++ L+ L P+ +VYLPP +K Sbjct: 6 NDVNVSTISLQMALWRPNESKVYLPPTPVSK 36
>EXON_SHV21 (Q01013) Alkaline exonuclease (EC 3.1.11.-)| Length = 483 Score = 27.3 bits (59), Expect = 8.8 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -3 Query: 397 LQSFEHPLNELKAVPRVDSQGQMCGSTF 314 L S E P+NE+ + D Q Q+C S+F Sbjct: 3 LFSEESPINEIGNMDMTDQQTQLCSSSF 30 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,285,181 Number of Sequences: 219361 Number of extensions: 854610 Number of successful extensions: 2528 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2512 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2528 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)