Clone Name | rbart27d08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | AIRE_MOUSE (Q9Z0E3) Autoimmune regulator (Autoimmune polyendocri... | 32 | 0.81 | 2 | KPCD1_MOUSE (Q62101) Serine/threonine-protein kinase D1 (EC 2.7.... | 30 | 3.1 | 3 | EXO1_XENLA (Q9W6K2) Exonuclease 1 (EC 3.1.-.-) (Exonuclease I) | 29 | 9.0 |
---|
>AIRE_MOUSE (Q9Z0E3) Autoimmune regulator (Autoimmune polyendocrinopathy| candidiasis ectodermal dystrophy protein homolog) (APECED protein homolog) Length = 552 Score = 32.3 bits (72), Expect = 0.81 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = -1 Query: 517 VRSSPCEVRLKFREEQK-GQESGDQGLLHLPRAIRLSLKRQDRPRAEEAEYKS*CSVCAD 341 VR+ +V + R+EQK GQ+ G L LP +++ K +D C+VC D Sbjct: 258 VRAKGAQVTIPGRDEQKVGQQCGVPPLPSLPSEPQVNQKNEDE-----------CAVCHD 306 Query: 340 GGQ 332 GG+ Sbjct: 307 GGE 309
>KPCD1_MOUSE (Q62101) Serine/threonine-protein kinase D1 (EC 2.7.11.13)| (nPKC-D1) (Protein kinase D) (Protein kinase C mu type) (nPKC-mu) Length = 918 Score = 30.4 bits (67), Expect = 3.1 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 463 QESGDQGLLHLPRAIRLSLKRQDRPRAEEAEYKS 362 Q +G+QGL + I LS D P AEE E K+ Sbjct: 877 QYAGEQGLQYPAHLISLSASHSDSPEAEEREMKA 910
>EXO1_XENLA (Q9W6K2) Exonuclease 1 (EC 3.1.-.-) (Exonuclease I)| Length = 734 Score = 28.9 bits (63), Expect = 9.0 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -2 Query: 459 RAAIKASSIFPEPSGSASKGKIDLALKRRNI 367 +A+ S FPEP GSA K K+ LK +++ Sbjct: 652 KASPAHQSFFPEPKGSAPKSKVPGLLKSQSV 682 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,714,808 Number of Sequences: 219361 Number of extensions: 1121179 Number of successful extensions: 2703 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2635 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2703 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3985467738 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)