| Clone Name | rbart27b04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RNS2_ARATH (P42814) Ribonuclease 2 precursor (EC 3.1.27.1) | 57 | 4e-08 | 2 | SYE_PYRAE (Q8ZU33) Glutamyl-tRNA synthetase (EC 6.1.1.17) (Gluta... | 30 | 5.3 | 3 | YBL2_STRCI (P33654) Hypothetical 14.2 kDa protein in blaB 3'region | 29 | 6.9 | 4 | R13L1_ARATH (Q9LRR4) Putative disease resistance RPP13-like prot... | 29 | 9.0 | 5 | YKX2_CAEEL (P34327) Hypothetical protein C13G5.2 | 29 | 9.0 |
|---|
>RNS2_ARATH (P42814) Ribonuclease 2 precursor (EC 3.1.27.1)| Length = 259 Score = 56.6 bits (135), Expect = 4e-08 Identities = 22/51 (43%), Positives = 36/51 (70%) Frame = -2 Query: 521 ICKKGSVQELRLCFTKDLKPRDCLTTSAMYKNLSKSKHCPRKISLPTYDPI 369 +CK+ ++ E+R+CF KD KPRDC+ + ++L+ K CP+ +SLP Y P+ Sbjct: 197 VCKRDAIDEIRICFYKDFKPRDCVGS----QDLTSRKSCPKYVSLPEYTPL 243
>SYE_PYRAE (Q8ZU33) Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA| ligase) (GluRS) Length = 570 Score = 29.6 bits (65), Expect = 5.3 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = +2 Query: 341 QSPVVNWRVRWDHMLAGRFFEGNALISI 424 Q P VN + WD ML GRF EG A++ I Sbjct: 223 QPPEVNLEL-WDKMLEGRFKEGEAVLRI 249
>YBL2_STRCI (P33654) Hypothetical 14.2 kDa protein in blaB 3'region| Length = 132 Score = 29.3 bits (64), Expect = 6.9 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -2 Query: 497 ELRLCFTKDLKPRDCLTTSAMYKNLSKSKHC 405 E+R CF+ L+ R C +TSA S K C Sbjct: 3 EVRSCFSSALRRRQCASTSAAVSATSSPKTC 33
>R13L1_ARATH (Q9LRR4) Putative disease resistance RPP13-like protein 1| Length = 1054 Score = 28.9 bits (63), Expect = 9.0 Identities = 21/66 (31%), Positives = 31/66 (46%) Frame = -3 Query: 427 TYRNQSIALEKSPCQHMIPSYSPIHHWRLSQKPATMGCTSLHPKILSIAGLRGNRCLHGP 248 +YRN KS C ++ P++H+ K CTSL+ LS N L GP Sbjct: 922 SYRNLQTLSIKSSCDTLVKF--PLNHFANLDKLEVDQCTSLYSLELS------NEHLRGP 973 Query: 247 DCLQDL 230 + L++L Sbjct: 974 NALRNL 979
>YKX2_CAEEL (P34327) Hypothetical protein C13G5.2| Length = 351 Score = 28.9 bits (63), Expect = 9.0 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 322 LSLASGTISSGELASTMGSYVGREIFRG 405 L+ SGT SSG + + GS +G IF G Sbjct: 238 LAATSGTYSSGSIGAYAGSVIGTSIFPG 265 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,240,258 Number of Sequences: 219361 Number of extensions: 1549218 Number of successful extensions: 3775 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3678 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3773 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3985467738 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)