| Clone Name | rbart27b01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ARSI_HUMAN (Q5FYB1) Arylsulfatase I precursor (EC 3.1.6.-) (ASI) | 28 | 6.3 | 2 | TXND3_ANTCR (P90666) Thioredoxin domain-containing protein 3 hom... | 28 | 8.3 |
|---|
>ARSI_HUMAN (Q5FYB1) Arylsulfatase I precursor (EC 3.1.6.-) (ASI)| Length = 569 Score = 28.1 bits (61), Expect = 6.3 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 124 HLRSSSIPQDPAYIYSEAHIIHTPLE 47 H+ +S PQ P ++Y +HTPL+ Sbjct: 218 HILASHSPQRPLFLYVAFQAVHTPLQ 243
>TXND3_ANTCR (P90666) Thioredoxin domain-containing protein 3 homolog| (Intermediate chain 1) Length = 837 Score = 27.7 bits (60), Expect = 8.3 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +1 Query: 73 LQNIYMLGLEVCLMNVSATGDDEKNY*LKGQKGVPGF 183 LQ I G EVCL + +D+ K Q+G P F Sbjct: 375 LQKIQEAGFEVCLQKMVQLTEDQAKEFYKEQEGTPHF 411 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,588,519 Number of Sequences: 219361 Number of extensions: 727082 Number of successful extensions: 1345 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1310 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1345 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)