Clone Name | rbart27a09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RPA2_NEUCR (O74633) DNA-directed RNA polymerase I polypeptide 2 ... | 28 | 4.8 | 2 | RPA2_SCHPO (Q9P7X8) Probable DNA-directed RNA polymerase I polyp... | 28 | 6.3 | 3 | TRMU_CAUCR (P58074) Probable tRNA (5-methylaminomethyl-2-thiouri... | 28 | 6.3 |
---|
>RPA2_NEUCR (O74633) DNA-directed RNA polymerase I polypeptide 2 (EC 2.7.7.6)| (RNA polymerase I subunit 2) Length = 1234 Score = 28.5 bits (62), Expect = 4.8 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 6 NTDPYECTNSSSINMSMCRMKAETLGVPKT 95 N P+ N S NM C+M +T+G P T Sbjct: 705 NMTPFSDFNQSPRNMYQCQMGKQTMGTPAT 734
>RPA2_SCHPO (Q9P7X8) Probable DNA-directed RNA polymerase I polypeptide 2 (EC| 2.7.7.6) (RNA polymerase I subunit 2) Length = 1227 Score = 28.1 bits (61), Expect = 6.3 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 6 NTDPYECTNSSSINMSMCRMKAETLGVPKT 95 N P+ N S NM C+M +T+G P T Sbjct: 740 NMTPFSDFNQSPRNMYQCQMGKQTMGTPGT 769
>TRMU_CAUCR (P58074) Probable tRNA| (5-methylaminomethyl-2-thiouridylate)-methyltransferase (EC 2.1.1.61) Length = 383 Score = 28.1 bits (61), Expect = 6.3 Identities = 13/47 (27%), Positives = 25/47 (53%) Frame = +3 Query: 60 RMKAETLGVPKTLSVLQHGFPKMIG*GYRD*YLQTPSPLFSIACQET 200 RM AE +G+P + + F + + + D YL+ +P+ + C +T Sbjct: 67 RMAAERIGIPHYVLDYESRFREQVIEDFADAYLRGETPIPCVRCNQT 113 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,640,913 Number of Sequences: 219361 Number of extensions: 631108 Number of successful extensions: 1349 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1349 length of database: 80,573,946 effective HSP length: 56 effective length of database: 68,289,730 effective search space used: 1638953520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)