| Clone Name | rbart27a06 |
|---|---|
| Clone Library Name | barley_pub |
>ITB8_HUMAN (P26012) Integrin beta-8 precursor| Length = 769 Score = 29.6 bits (65), Expect = 3.6 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 124 YRACSYIFVEGWHCMRQMHPQSLKQSI 204 Y AC E W+CM+ +HP +L Q+I Sbjct: 631 YTACK----ENWNCMQCLHPHNLSQAI 653
>CRF1_YEAST (Q04930) Transcription factor CRF1 (Corepressor with FHL1 protein| 1) Length = 467 Score = 29.6 bits (65), Expect = 3.6 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -3 Query: 449 TAR*DGHRQSSSSSVEPTNQQESSVLAGVLINQSINFC 336 T++ + HRQ S S TN+ E + +L++ I+ C Sbjct: 150 TSKSESHRQYHSPSASTTNEDEEDIGVDILVDNHIDSC 187
>YADC_SCHPO (Q09837) Putative glycosyl transferase C4G8.12c in chromosome I (EC| 2.-.-.-) Length = 533 Score = 28.9 bits (63), Expect = 6.2 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -3 Query: 194 FRLCGCICRMQCQPSTNM*LHALYPFTKHDRIYVLLL 84 F LC CIC+ C P YP R+Y+ L+ Sbjct: 75 FLLCRCICKSNCSP---------YPILLFTRLYMCLI 102
>RFL1_ARATH (Q8L3R3) Disease resistance protein RFL1 (RPS5-like protein 1)| (pNd13/pNd14) Length = 885 Score = 25.0 bits (53), Expect(2) = 7.5 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -1 Query: 199 IVSDFADASAACNANPLRICNCMLC 125 I + F D + CNA R+C C C Sbjct: 82 IENQFNDLLSTCNAEIQRLCLCGFC 106 Score = 21.9 bits (45), Expect(2) = 7.5 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = -2 Query: 408 RRTNQPARELCFGGSFNQSIN*FLWEIEEA 319 R NQ ++ LC GS+ Q+++ L +++A Sbjct: 13 REVNQFSQWLCVSGSYIQNLSENLASLQKA 42
>ECM17_YEAST (P47169) Sulfite reductase [NADPH] beta subunit (EC 1.8.1.2)| (Extracellular matrix protein 17) Length = 1442 Score = 28.5 bits (62), Expect = 8.1 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = +1 Query: 355 LIKTPAKTELSCWLVGSTEEDDD*RWPS 438 L KT A E+ WL G E+DDD WPS Sbjct: 1013 LPKTTAYHEV--WLEGPEEQDDDPSWPS 1038 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,527,358 Number of Sequences: 219361 Number of extensions: 1056891 Number of successful extensions: 2018 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1978 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2018 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)