Clone Name | rbart26h12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ZC3H3_MOUSE (Q8CHP0) Zinc finger CCCH-type domain-containing pro... | 29 | 5.5 |
---|
>ZC3H3_MOUSE (Q8CHP0) Zinc finger CCCH-type domain-containing protein 3| Length = 950 Score = 28.9 bits (63), Expect = 5.5 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = -1 Query: 373 AVDPAGHLQQLPRRKQAPQGHPAPVAVRQPHRGALGRHTEPSACL 239 A HL Q RR+QA +G +PV + PH+G + + CL Sbjct: 464 ATTSKNHLTQ--RRRQALRGKNSPVLRKTPHKGLMQVNRHRLCCL 506 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,917,646 Number of Sequences: 219361 Number of extensions: 866371 Number of successful extensions: 2102 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2029 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2102 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)