Clone Name | rbart26g05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NDST_CAEEL (Q966W3) Bifunctional heparan sulfate N-deacetylase/N... | 28 | 6.9 |
---|
>NDST_CAEEL (Q966W3) Bifunctional heparan sulfate| N-deacetylase/N-sulfotransferase 1 (EC 2.8.2.8) (Glucosaminyl N-deacetylase/N-sulfotransferase 1) [Includes: Heparan sulfate N-deacetylase 1 (EC 3.-.-.-); Heparan sulfate N-sulfotransferase 1 (EC 2.8.2.-)] Length = 852 Score = 28.1 bits (61), Expect = 6.9 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +3 Query: 15 FSFVENAQAIFLVPNNNVEITHL-LSSTASVFEWTKCFGSFKLNWQNIL 158 F+ + N +IF+ N L L + ++F + KC+ + KL WQ+ L Sbjct: 492 FTILLNPISIFMTHQQNYAYDRLALYTFENLFRFIKCWTNIKLKWQDPL 540 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,289,589 Number of Sequences: 219361 Number of extensions: 318012 Number of successful extensions: 577 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 575 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 577 length of database: 80,573,946 effective HSP length: 28 effective length of database: 74,431,838 effective search space used: 1786364112 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)