Clone Name | rbart26g04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | JHD1_CRYNE (Q55NZ6) JmjC domain-containing histone demethylation... | 34 | 0.11 | 2 | YA84_SCHPO (Q09773) Hypothetical protein C22F3.04 in chromosome I | 28 | 4.4 | 3 | RBL_SYNP2 (Q44176) Ribulose bisphosphate carboxylase large chain... | 28 | 5.8 | 4 | URB1_USTMA (P40349) Siderophore biosynthesis regulatory protein ... | 28 | 7.6 |
---|
>JHD1_CRYNE (Q55NZ6) JmjC domain-containing histone demethylation protein 1 (EC| 1.14.11.-) Length = 879 Score = 33.9 bits (76), Expect = 0.11 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = +2 Query: 86 RENPSTGVVYFRSNLILPHTTMLGAHRGSPDLFFNRSREHQASSHASTSRANVASKCPPS 265 + + ST +SN+ P T+ G SP++ RE QA S A T ++ P Sbjct: 152 KRSASTSAPLLKSNIKRPRTSTKGQETASPEIDMKSEREQQAESTAGTPASDAPQGRPKR 211 Query: 266 RIA 274 + A Sbjct: 212 KTA 214
>YA84_SCHPO (Q09773) Hypothetical protein C22F3.04 in chromosome I| Length = 1428 Score = 28.5 bits (62), Expect = 4.4 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 89 ENPSTGVVYFRSNLILPHTTMLGAHRGSPDLFFNR 193 E P G + F S + L HT +LG + G P L + Sbjct: 1016 EKPIIGGIEFSSGMGLLHTALLGVYAGVPTLLIKQ 1050
>RBL_SYNP2 (Q44176) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) Length = 470 Score = 28.1 bits (61), Expect = 5.8 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 312 RERTQAPMRQGNEAMREGGHFEATLARLVDAW 217 R ++ R+GN+ +RE G + LA +D W Sbjct: 426 RNEGRSLAREGNDVLREAGKWSPELAAALDLW 457
>URB1_USTMA (P40349) Siderophore biosynthesis regulatory protein URBS1| Length = 950 Score = 27.7 bits (60), Expect = 7.6 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +2 Query: 194 SREHQASSHASTSRANVASKCPPSRIASFP 283 S HQ ++ AS+S ++ +S PP RIA+ P Sbjct: 18 SHHHQQAAAASSSSSSSSSHHPPPRIAARP 47 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,768,133 Number of Sequences: 219361 Number of extensions: 813167 Number of successful extensions: 2337 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2299 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2337 length of database: 80,573,946 effective HSP length: 81 effective length of database: 62,805,705 effective search space used: 1507336920 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)