| Clone Name | rbart26f12 |
|---|---|
| Clone Library Name | barley_pub |
>STA5A_SHEEP (P42231) Signal transducer and activator of transcription 5A| (Mammary gland factor) Length = 794 Score = 29.6 bits (65), Expect = 4.3 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 148 RTVQLIHTNQT*ILCSPPISWNQSHTWSLLEQTRRS 255 +T+QL+ QT IL I W + H W +E RS Sbjct: 236 KTLQLLRKQQTIILDDELIQWKRRHDWRGMEAPPRS 271
>CBIO1_MYCMS (Q6MSQ2) Cobalt import ATP-binding protein cbiO 1| Length = 303 Score = 29.3 bits (64), Expect = 5.6 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -1 Query: 244 FVPRETTCVIGSTRSGVST--EFTSGLCVS 161 F + TCVIG+T SG ST + T+GL +S Sbjct: 48 FKKNKVTCVIGTTGSGKSTMIQLTNGLIIS 77
>CCPR_YARLI (Q6C0Z6) Cytochrome c peroxidase, mitochondrial precursor (EC| 1.11.1.5) (CCP) Length = 340 Score = 28.9 bits (63), Expect = 7.3 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 198 PDLVEPITHVVSLGTNQTFNNQQHVALYGTRLL 296 PD + THV ++ Q FN+Q+ VAL G L Sbjct: 194 PDASQGATHVRNVFNRQGFNDQEMVALIGAHAL 226
>CBIO2_MESFL (Q6F1W4) Cobalt import ATP-binding protein cbiO 2| Length = 315 Score = 28.5 bits (62), Expect = 9.6 Identities = 14/27 (51%), Positives = 20/27 (74%), Gaps = 2/27 (7%) Frame = -1 Query: 235 RETTCVIGSTRSGVST--EFTSGLCVS 161 ++ TCVIG+T SG ST + T+GL +S Sbjct: 61 KKITCVIGTTGSGKSTMIQLTNGLLIS 87
>CBIO2_SPIKU (Q6XYZ3) Cobalt import ATP-binding protein cbiO 2| Length = 305 Score = 28.5 bits (62), Expect = 9.6 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = -1 Query: 295 SSLVPYRATCC*LLNVWFVPRETTCVIGSTRSGVST 188 S PY T +NV P + T +IGST SG ST Sbjct: 28 SPKTPYEYTSLQDINVVIKPGKITAIIGSTGSGKST 63
>ENV_HV2RO (P04577) Envelope polyprotein GP160 precursor [Contains: Exterior| membrane glycoprotein (GP120); Transmembrane glycoprotein (GP41)] Length = 858 Score = 28.5 bits (62), Expect = 9.6 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 170 QTRREFCAHPRSRGTNHTRGLSWNKP 247 + + HPR RGTN TR +S+ P Sbjct: 352 EVKETLAKHPRYRGTNDTRNISFAAP 377 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,037,624 Number of Sequences: 219361 Number of extensions: 917146 Number of successful extensions: 2224 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2199 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2224 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)