Clone Name | rbart26e03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ATS17_HUMAN (Q8TE56) ADAMTS-17 precursor (EC 3.4.24.-) (A disint... | 30 | 4.0 | 2 | TRPD_CAUCR (Q9A728) Anthranilate phosphoribosyltransferase (EC 2... | 30 | 4.0 | 3 | CESA6_ARATH (Q94JQ6) Cellulose synthase A catalytic subunit 6 [U... | 29 | 6.8 | 4 | OS25_PLARE (P19455) 25 kDa ookinete surface antigen precursor (P... | 28 | 8.9 |
---|
>ATS17_HUMAN (Q8TE56) ADAMTS-17 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase with thrombospondin motifs 17) (ADAM-TS 17) (ADAM-TS17) Length = 1095 Score = 29.6 bits (65), Expect = 4.0 Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Frame = -2 Query: 392 PRPA--QGAIASDAVRSWRAQGATAADAVCSRCAGRAIVPCTSTIDGLDVRTCPR 234 PRPA Q D + W A + A C + + V CT++ D T PR Sbjct: 908 PRPAAVQSCEGQDCLSIWEASEWSQCSASCGKGVWKRTVACTNSQGKCDASTRPR 962
>TRPD_CAUCR (Q9A728) Anthranilate phosphoribosyltransferase (EC 2.4.2.18)| Length = 341 Score = 29.6 bits (65), Expect = 4.0 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = -2 Query: 392 PRPAQGAIASDAVRSWRAQGATAAD-AVCSRCAGRAIVPCTSTIDGLDV 249 P PAQ A A A+R +G T + A C+R RA +P D +DV Sbjct: 35 PTPAQVAAAVTAIR---LRGETVGEIAACARAMRRAAIPLEHPYDVIDV 80
>CESA6_ARATH (Q94JQ6) Cellulose synthase A catalytic subunit 6 [UDP-forming] (EC| 2.4.1.12) (AtCesA-6) (Isoxaben resistant protein 2) (Protein PROCUSTE1) (Protein Quill) (AraxCelA) Length = 1084 Score = 28.9 bits (63), Expect = 6.8 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -1 Query: 354 PFLACPRCHCRRRRLFPVCRPC 289 PF+AC C FPVCRPC Sbjct: 54 PFVACNEC------AFPVCRPC 69
>OS25_PLARE (P19455) 25 kDa ookinete surface antigen precursor (Prs25)| Length = 217 Score = 28.5 bits (62), Expect = 8.9 Identities = 25/106 (23%), Positives = 44/106 (41%), Gaps = 6/106 (5%) Frame = -2 Query: 320 DAVCSR-----CAGRAIVPCTSTIDGLDVRTCPRPCMHDSRV**NCKDPTMHKPYGYFNL 156 D VC + +G C + + ++ TC + C + T++KP G F+ Sbjct: 27 DTVCKKGFLIQMSGHLECKCENDLVLVNEETCEEKVL-------KCDETTVNKPCGDFSK 79 Query: 155 IVFV*AAPVS-ACK*KSTHLFTCVVSFRLVRVVWMCVLYACTFMWC 21 + + +P+S ACK C + +V V C+L C + C Sbjct: 80 CIKIDGSPISYACK--------CNPGYDMVNNV--CILNECKNVTC 115 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,152,262 Number of Sequences: 219361 Number of extensions: 1290433 Number of successful extensions: 3689 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3679 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)