Clone Name | rbart26c09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GPRS_DROME (O61366) Serine-enriched protein | 29 | 8.5 |
---|
>GPRS_DROME (O61366) Serine-enriched protein| Length = 1302 Score = 28.9 bits (63), Expect = 8.5 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = +2 Query: 179 QLPRK*IDSITPSINAKTLDTPNRTLHLVKPTWPHHRPGVVKADCNTSSR 328 QL +D+ T IN + LD+ + LV+ W G DC SSR Sbjct: 943 QLRSPGVDTETDLINLQRLDSGGDSFELVESKWSKSSRGESSFDCPYSSR 992 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,734,859 Number of Sequences: 219361 Number of extensions: 1405198 Number of successful extensions: 2779 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2726 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2779 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3754426130 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)