| Clone Name | rbart26c04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GLGC_NITEU (Q82T88) Glucose-1-phosphate adenylyltransferase (EC ... | 29 | 5.0 |
|---|
>GLGC_NITEU (Q82T88) Glucose-1-phosphate adenylyltransferase (EC 2.7.7.27)| (ADP-glucose synthase) (ADP-glucose pyrophosphorylase) (ADPGlc PPase) Length = 433 Score = 28.9 bits (63), Expect = 5.0 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = +2 Query: 71 SWLKMILVFPWRGLPRGQNISSNPFRKKKHFKTRGKQVAWILMHLLATSIH 223 ++LK ++V +P G + NP +KHF + I +L IH Sbjct: 380 AYLKRVVVEKECQIPEGLKVGFNPDEDRKHFYVTDDGITLITPEMLGQGIH 430 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,852,151 Number of Sequences: 219361 Number of extensions: 952860 Number of successful extensions: 2073 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2001 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2073 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)