Clone Name | rbart26b04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | POL1_TORVR (P29150) RNA1 polyprotein (P1) [Contains: X1 protein;... | 29 | 8.7 |
---|
>POL1_TORVR (P29150) RNA1 polyprotein (P1) [Contains: X1 protein; X2 protein;| Putative ATP-dependent helicase (EC 3.6.1.-) (NTP-binding protein) (NTB) (Membrane-binding protein); Viral genome-linked protein (VPg); Picornain 3C-like protease (EC 3.4.22.-) Length = 2197 Score = 28.9 bits (63), Expect = 8.7 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +1 Query: 58 GSLYLATNPSLHCSLVENEQITHFKPWNPSHIYNITKP 171 G +L+ HC+ +EQ + +KPW+P + P Sbjct: 1996 GGNFLSLPQWRHCASFHDEQYSQWKPWSPVKFLEVDVP 2033 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,288,740 Number of Sequences: 219361 Number of extensions: 1571226 Number of successful extensions: 3208 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3208 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3869946934 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)