Clone Name | rbart25h09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | POL_BAEVM (P10272) Pol polyprotein [Contains: Protease (EC 3.4.2... | 29 | 3.2 | 2 | YAE7_YEAST (P39723) Protein YAL047C | 29 | 3.2 |
---|
>POL_BAEVM (P10272) Pol polyprotein [Contains: Protease (EC 3.4.23.-); Reverse| transcriptase/ribonuclease H (EC 2.7.7.49) (EC 3.1.26.4) (RT); Integrase (IN)] Length = 1189 Score = 29.3 bits (64), Expect = 3.2 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 17 IYRNDQTHPDHPHQEGENIYVHRH 88 +YR + HP Q G+++YV RH Sbjct: 1098 LYRPGHSQTSHPFQVGDSVYVRRH 1121
>YAE7_YEAST (P39723) Protein YAL047C| Length = 622 Score = 29.3 bits (64), Expect = 3.2 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +2 Query: 2 DKTDPIYRNDQTHPDHPHQEGENIYVHRHA*FIEAKESRVAVT 130 + TD Y+ND+ H + H + EN+ + + I A ESR T Sbjct: 249 ENTDGGYQNDEIHDSNNHIDTENVMANSTSLPISAVESRFEKT 291 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,785,433 Number of Sequences: 219361 Number of extensions: 302215 Number of successful extensions: 755 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 736 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 755 length of database: 80,573,946 effective HSP length: 19 effective length of database: 76,406,087 effective search space used: 1833746088 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)