| Clone Name | rbart25h01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CARB_CAUCR (Q9A4D6) Carbamoyl-phosphate synthase large chain (EC... | 32 | 0.79 | 2 | NOL11_XENLA (Q6INI5) Nucleolar protein 11 | 30 | 3.0 | 3 | EXG_KLULA (Q12628) Glucan 1,3-beta-glucosidase precursor (EC 3.2... | 30 | 3.9 | 4 | SYG_MYCPE (Q8EW64) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine... | 29 | 8.7 |
|---|
>CARB_CAUCR (Q9A4D6) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1099 Score = 32.3 bits (72), Expect = 0.79 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +1 Query: 187 VSIQFSMNDPHSNNMFMLHRVDSKPRLSVPTVNPRAQRKKP 309 +++QF++ +PHS+N PR+ V VNPRA R P Sbjct: 838 MNVQFAIEEPHSDN----------PRIYVLEVNPRASRTVP 868
>NOL11_XENLA (Q6INI5) Nucleolar protein 11| Length = 720 Score = 30.4 bits (67), Expect = 3.0 Identities = 19/55 (34%), Positives = 31/55 (56%) Frame = +2 Query: 35 SDPNEYPSSKFVHILVFYNNTVQYSLKLTKYTPLNYFYLFMEKQEKPIQAVSVYS 199 +DP YP S FV ++ NT+ YSL P + LF+EK++ P+ + ++S Sbjct: 443 ADPKFYPQSSFVQLV--QTNTLSYSL-----CP-DLLSLFLEKRDVPLLQLCLHS 489
>EXG_KLULA (Q12628) Glucan 1,3-beta-glucosidase precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 429 Score = 30.0 bits (66), Expect = 3.9 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -3 Query: 464 IILLVSTLIGICLLMNMPLTKDTLLYSNVKI 372 ++ L+S L+ +CL +PL+K Y N K+ Sbjct: 6 VVSLISLLVSVCLAQPLPLSKRYFEYENYKV 36
>SYG_MYCPE (Q8EW64) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA| ligase) (GlyRS) Length = 462 Score = 28.9 bits (63), Expect = 8.7 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 85 LQQYSTIFAEIDKIHSPQLFLFIYGKAREAHTSSVSIQFSMNDPH 219 L+ T + KIH + + Y K AH SS ++ F N PH Sbjct: 239 LESIKTFLFKTLKIHENNIKIIDYPKEELAHYSSRTVDFLYNFPH 283 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,925,901 Number of Sequences: 219361 Number of extensions: 1492194 Number of successful extensions: 3778 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3628 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3774 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3869946934 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)