Clone Name | rbart25g06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MEND_HAEIN (P44612) Menaquinone biosynthesis protein menD [Inclu... | 31 | 0.97 |
---|
>MEND_HAEIN (P44612) Menaquinone biosynthesis protein menD [Includes:| 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 2.5.1.64) (SHCHC synthase); 2-oxoglutarate decarboxylase (EC 4.1.1.71) (Alpha-ketoglutarate decarboxylase) (KDC)] Length = 568 Score = 30.8 bits (68), Expect = 0.97 Identities = 18/38 (47%), Positives = 24/38 (63%) Frame = +2 Query: 104 EFVSLSWFFSTFIEQELGRSNDGVAEAGFPLRLPRLHP 217 E ++LS F +TFIEQ++G + EA LRLP L P Sbjct: 355 EPLALSKFCATFIEQQVG---GNLTEASLALRLPTLLP 389 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,804,538 Number of Sequences: 219361 Number of extensions: 447418 Number of successful extensions: 1105 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1098 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1105 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)